Conserved Protein Domain Family
PLN00067

?
PLN00067: PLN00067 
PsbP domain-containing protein 6; Provisional
Statistics
?
PSSM-Id: 177697
View PSSM: PLN00067
Aligned: 10 rows
Threshold Bit Score: 413.148
Threshold Setting Gi: 302766653
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15228983    1 MATASLVPTSKIFSVSPKSSASIKARSRVVVASS---------------------QQQQQPRRRELLLKSAVAiPAILQL 59 
115440559   2 ASSSVFSPLLRALRPSTSCSGRSSATHDNSAAAVvaagga---------aprpapLAAVVSHRRELLLGAALG-AAFLKA 71 
168045858   1 MASCSTSSKPLWPSSSSLGRFSFSSSSNPAVSCSlsnnqstsqlctaqslsspdsREVVTIGRRELLLGGVAS-SLILGV 79 
225440155   1 MATASFAPLSHVFSRLSHISSSKSATSILPHSSPfk------------------nSPNQLTFRREFLKGLALA-PLIFIS 61 
242054707   2 ASSSVFSPLFTSLRLPVPTAISCCASPPQGVASAvhdavp----------rpvppLVAVASHRRELVLGAALT-AVLSRA 70 
224086769   1 MATASLTPIFSSPLKTSRTTTLTTTTTSLDQ------------------------HRNQVVLRRQILKGLVLS-PLILIK 55 
255570482   1 MATASLSP---FFSTSTSPKYPLKTSPPTTITAIvc------------------kNRSNSTLRRQILKGIAVS-PLILIK 58 
297816988   1 MATASLVLTSKVFSVSSKCSALIKARTGVVVASA---------------------QQQQQPRRRELLLKSAVAiPAILQL 59 
302766653   1 -------------------------------------------------------------------MGLAVN-QTS--- 9  
302792471   1 MALRAVVPWTLPGAAPLQLNASSSAIRCDAQENP---------------------RAATVISRRKSLVGFTLA---MGLA 56 
15228983   60 KEapISAAREVEVGSYLPLSPSDPSFVLFKAKPSDTPALRAGNVQPYQFVLPPNWKQLRIANILSGNYCQPKCAEPWIEV 139
115440559  72 PL--PAEAREVEVGAVLPPAASNPGFVFFRATSKDTPALRAGNVQPYEFILPPTWKQTRVANILSGNYCQPKCAEPWVEV 149
168045858  80 GNs-AEAYTQVEVGAFLPPAEGNPNYVQFVASPKDTPALRAGNVKPYKFILPPAWKPVRVANILSGNYCQPKCAEPWVEV 158
225440155  62 EEalPAHAREVEVGSYLPTSPSDPSFVLFKASPKDTPALRAGNVQPYQFVLPPTWKQTRVANILSGNYCQPKCAEPWVEV 141
242054707  71 PLp-PAQAREVEVGTYLPPAPSNPGFVFFRATPKDTPALRAGNVEPYEFILPPTWKQARVANILSGNYCQPKCAEPWVEV 149
224086769  56 APp-SSEAREIEVGSYLPPSPTDPSFVLFKASSKDTPALRAGNVQPYQFILPPSWKQTRVANILSGNYCQPKCAEPWVEV 134
255570482  59 EAp-ISEAKEVEVGSYLPSSPSDPSFVLFKASPKDTPALRAGNVQPYQFILPPTWKQARVANILSGNYCQPKCAEPWVEV 137
297816988  60 KEapISEAREVEVGSYLPPSPSDPSFVLFKAKPSDTPALRAGNVQPYQFVLPPNWKQLRIANILSGNYCQPKCAEPWIEV 139
302766653  10 -----ALAREVEVGAYLPPVESLPGFVQFKASGRDTPALRAGNVQPYEFILPSTWKQQRIANILSGNYCQPKCAEPWVEV 84 
302792471  57 ANqtAALAREVEVGAYLPPVESLPGFVQFKASGRDTPALRAGNVQPYEFILPSTWKQQRIANILSGNYCQPKCAEPWVEV 136
15228983  140 KFENEKQGKVQVVASPLIRLTNKPNATIEDLGEPEKVIASLGPFVTGNSYDSDELLKTSIEKIGDQTYYKYVLETPFALT 219
115440559 150 KFEDDKQGKVQVVASPLIRLTNRPNATIEDIGSPERLIASLGPFVTGNTFDSDELVDTSVEKIDGQTYYSYVLETPLALT 229
168045858 159 KFENAKEGTVQVVVSPMVRLTNKANASIEEIGPPEKIISALGPFVTGNSFDPDEVLETSVEKKGDLTYYNYQLETPFALT 238
225440155 142 KFEDENQGKVQVVASPLIRLTNKPNASIEDIGSPEKLIASLGPFVTGNTYDSDELLETSVEKLGDQTYYKYVLETPFALT 221
242054707 150 KFEDEKQGKVQVVASPLIRLTNKPNATIQDIGSPERLIASLGPFVTGNTFDPDELVDTNVENVDGQTYYSYVLETPLALT 229
224086769 135 KFEDEKQGKVQVVASPLIRLTNKPNATIEEIGNPEKLIASLGPFVTGNSYDPDELLETKIEKFGDQTYYKYMLETPFALT 214
255570482 138 KFEDEKQGKVQVVASPLIRLTNKPNATIEEIGTPEKLIASLGPFVTGNSYDPDELLETSIEKLGDQTYYKYVLETPYALT 217
297816988 140 KFENEKQGKVQVVASPLIRLTNKPNATIEDIGEPEKVIASLGPFVTGNSYDSDELLKTSIEKIGDQTYYKYVLETPFALT 219
302766653  85 KFEDDKEGSLQVVAAPMVRLTNKPNARIDEIGSPEKLIAALGPFVTGNSYDPDEVIETSVKDRDGEKFYCYTLETPYAKT 164
302792471 137 KFEDDKEGSLQVVAAPMVRLTNKPNARIDEIGSPEKLIAALGPFVTGNSYDPDEVIETSVKDRDGEKFYCYTLETPYAKT 216
15228983  220 GSHNLAKATAKGSTVVLFVVSATEKQWQSSQKTLEAILDSFQL 262
115440559 230 GSHNLAKATAKGNTVVLFVASASDKQWQSSEKVLKTIVDSFKV 272
168045858 239 GAHNLAAATASGNVVLLFVVSASDKQWASSQDLLRTVLESFSA 281
225440155 222 GSHNLAKATAKGNSVVLFVASANDKQWQASQKTLKAMLDSFQV 264
242054707 230 GSHNLAKATAKGSTGCCSSRAPTTSSGRRRRRF---------- 262
224086769 215 GTHNLAKATAKGSTVVLFVASANDKQWQASEKTLKAILDSFQI 257
255570482 218 GTHNLAKATAKGSTVVLFVASANDKQWQASEKTLKAIIDSFIV 260
297816988 220 GSHNLAKATAKGNTVVLFVVSATEKQWQSSQKTLEAILDSFQL 262
302766653 165 GAHNLAAATSKGNVVLLFVVSASESQWSKSESVLRTILDSFKA 207
302792471 217 GTHNLAAATSKGNVVLLFVVSASESQWSKSESVLRTILDSFKA 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap