Conserved Protein Domain Family
PLN00062

?
PLN00062: PLN00062 
TATA-box-binding protein; Provisional
Statistics
?
PSSM-Id: 177693
View PSSM: PLN00062
Aligned: 36 rows
Threshold Bit Score: 285.051
Threshold Setting Gi: 161899533
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219113475   1 MIRIQNMSSTVNLGTRLDLKKIALKCRNTEFNPRRFGAVIMRLREPRATALIFSSGKMCVTGVKSTHNANLAAKKFAYIV 80 
145352509  30 VPVLQNIVATVNLDCKLDLKTIAFHARNVEYNPKRFAAAIMRIRNPKTTALIFSSGKMVCTGAKTEALAREAARKYAKVI 109
162605642  72 TPNIQNVVSTVSLGIQLDLKRIALKARNAEYNPRRFAAVIMRIRDPKTTALIFSSGKMVVTGAKSEDSARVACKKYARII 151
162605926  72 TPNIQNVVSTVSLGIQLDLKRIALKARNAEYNPRRFAAVIMRIRDPKTTALIFSSGKMVVTGAKSEDSARVACKKYARII 151
162606298  72 TPNIQNVVSTVSLGIQLDLKRIALKARNAEYNPRRFAAVIMRIRDPKTTALIFSSGKMVVTGAKSEDSARVACKKYARII 151
224009416   1 ---------TADLGVRLDLKQIALRCRNTEFNPRRFAAVIMRLREPRATALLFSSGRMVITGTKSSHNCSLATKKFAYIL 71 
255078440  38 VPQLQNIVATVNLDCKLDLKTIAFHARNVEYNPKRFAAAIMRIRAPKTTALIFSSGKMVCTGAKTEALAREAARKYAKVI 117
160331843  90 IPDVQNVVSTVSLGIQLDLKRIALKARNAEYNPRRFAAVIMRIRDPKTTALIFSSGKMVITGAKSEEAAKLGCKKYARII 169
303283248  43 VPTLQNIVATVNLDCKLDLKTIAFHARNVEYNPKRFAAAIMRIRAPKTTALIFSSGKMVCTGAKTEALAREAARKYAKVI 122
302833409   9 TPQLQNVVATVNLGTKLDLKEIAMHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDDSRTAARRYAKIV 88 
219113475  81 ERVGFkPKENIDFKVQNIVGTADVGFPIRLEGLVYAHSAFASYEPELFPGLIYRFVNPRVVFLIFVSGKIVITGAKKEMD 160
145352509 110 IKLGF-PAQFKDFKIQNMVGSCDVQFPIRLEGLAWQHGHFAQYEPELFPGLIYRMQMPKIVLLIFVSGKIVLTGGKRRED 188
162605642 152 QRLGYgHAKFIDFRIQNIVASCDVRFPIRLESLAHAHNQFCSYEPELFPGLIYRMITPKVVLLIFVSGKLVLTGAKQRND 231
162605926 152 QRLGYgHAKFIDFRIQNIVASCDVRFPIRLESLAHAHNQFCSYEPELFPGLIYRMITPKVVLLIFVSGKLVLTGAKQRND 231
162606298 152 QRLGYgHAKFIDFRIQNIVASCDVRFPIRLESLAHAHNQFCSYEPELFPGLIYRMITPKVVLLIFVSGKLVLTGAKQRND 231
224009416  72 ERVGFqPAGFIDFKIQNVVGTVDVGFPIRLEGVVYAHPTFSSYEPELFPGLIYRLVQPRVVLLIFVSGKVVITGAKTEEQ 151
255078440 118 SKLGF-PAQFKDFKIQNMVGSCDVKFPIRLEGLAWSHGHFAQYEPELFPGLIYRMQMPKIVLLIFVSGKIVLTGGKNRDD 196
160331843 170 QRLGYgHVKFLDFRIQNIVASCDVKFPIRLESLAHAHNQFCSYEPELFPGLIYRMITPKVVLLIFVSGKLVLTGAKERKD 249
303283248 123 SKLGF-PAQFKEFKIQNMVGSCDVKFPIRLEGLAWSHGHFAQYEPELFPGLIYRMVVPKIVLLIFVSGKIVLTGGKKRED 201
302833409  89 QKLGF-PATFKEFKIQNIVGSCDVKFPIRLEGLAYAHSLFASYEPELFPGLIYRMKQPKIVLLIFVSGKVVLTGAKTRYE 167
219113475 161 LAHALTKLFPVLMEFKKTHI 180
145352509 189 IYQAFENIYPVLTEFKKLAQ 208
162605642 232 IFQAFSNIYSVLCLYKKT-- 249
162605926 232 IFQAFSNIYSVLCLYKKT-- 249
162606298 232 IFQAFSNIYSVLCLYKKT-- 249
224009416 152 MVEALRKVYPVLVEFR---- 167
255078440 197 IYKAFENIYPVLTEFRKLPN 216
160331843 250 IYQAFNNIYAVLCLFKKT-- 267
303283248 202 IYQAFENIYPVLTEFRKVAN 221
302833409 168 IYQAYMNIYPTLIQYKKGDA 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap