Conserved Protein Domain Family
PLN00060

?
PLN00060: PLN00060 
meiotic recombination protein SPO11-2; Provisional
Statistics
?
PSSM-Id: 177691
View PSSM: PLN00060
Aligned: 6 rows
Threshold Bit Score: 608.416
Threshold Setting Gi: 302808341
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115474861   1 MAEAGVAAASLFGADRRLCSADILPPAEV--RARIEVAVLNFLAALTDPaAPAISALPLISRGAANRGLRRALLrDDVSS 78 
30696943    1 MEESSGLSSMKFFSDQHLSYADILLPHEA--RARIEVSVLNLLRILNSP-DPAISDLSLINRKRSNSCINKGIL-TDVSY 76 
242080619   1 MAEANVAAASLFGADSRLCSADILAPPEAkvRARIEVAVLNFLAALASPsSPAISVLPLISRSSANCSLRSGLL-NDVSS 79 
297836981   1 MEESSGLSSMKFFSDQHLSYADILRPHEA--RARIEVSVLNLLRILNSP-DPAISDLSLINRKRSNSCINQGIL-TDVSY 76 
302806102   1 ---MACHGLTPFESNELSSTADLVSPEE-------------------------------VRRNCSNVLMQRGLLqGD--N 44 
302808341   1 ---MACHGLTPFESNELSSTADLVSPEE-------------------------------VRRNCSNVLMQRGLLqGD--N 44 
115474861  79 VYLSYASCKRSLTRANDAKAFVRVWKVMEMCYKILGEGKLVTLRELFYTLLSESPTYFTCQRHVNQTVQ-DVVSLLRCTR 157
30696943   77 IFLSTSFTKSSLTNAKTAKAFVRVWKVMEICFQILLQEKRVTQRELFYKLLCDSPDYFSSQIEVNRSVQ-DVVALLRCSR 155
242080619  80 VYLSHTFCKRSLMH--NPKAFVRVWKVMEMCYKILGEGKLVHQRELFYKLLSDSPKYFSCQRHVNQAIQ-DVVSLLRCTR 156
297836981  77 IFLSTSFTKSSLTNAKTAKTFVRVWKVMEICFQILLQEKRVTQRELFYKLLCDSPDYFSSQIEVNRTVQ-DVVALLRCSR 155
302806102  45 IFLSHLDSTLSFTKSGSMKRYFRVWKMLELCYQLLTLGKKATQREIFYRLLCDASEYFQCQEQKAKTMHaDVVGILKCSR 124
302808341  45 IFLSHLDSTLSFTKSGSMKRYFRVWKMLELCYQLLTLGKKATQREIFYRLLCDASEYFQCQEQKAKTMHaDVVGILKCSR 124
115474861 158 QSLGIMASSRGALIGRLVVQGPEEEHVDCSILGPSGHAITGDLNVLSKLIFSSDARYIIVVEKDAIFQRLAEDRIYSHLP 237
30696943  156 YSLGIMASSRGLVAGRLFLQEPGKEAVDCSACGSSGFAITGDLNLLDNTIMRTDARYIIIVEKHAIFHRLVEDRVFNHIP 235
242080619 157 QSLGVMASSRGALIGRLVLHEPDEEQIDCSILGASGHAITGDLNLLSKLNLSSDARYIIVVEKDAIFQRLAEDRLYNQLP 236
297836981 156 YSLGIMASSRGLVAGRLFLQEPGKEAVDCSACGSSGFTITGDLNLLDNTIMRSDARYIIIVEKHAIFHRLVEDRVFNHIP 235
302806102 125 YSLGILASARGAIVGRLVIQELNREPVDCTKIGINGYIIDGDLELLQNLTLTSDARYILVIEKDAVFQRLSEDRFFQTIP 204
302808341 125 YSLGILASARGAIVGRLVIQELNREPVDCTKIGINGYIIDGDLELLQNLTLTSDARYILVIEKDAVFQRLSEDRFFQTIP 204
115474861 238 CILITAKGYPDLATRFILHRLSQTYPNMPIFALVDWNPAGLAILCTYKYGSISMGLESYRYACNVKWLGLRGDDLQLIPQ 317
30696943  236 CVFITAKGYPDIATRFFLHRMSTTFPDLPILVLVDWNPAGLAILCTFKFGSIGMGLEAYRYACNVKWIGLRGDDLNLIPE 315
242080619 237 CILITAKGYPDIATRFILHRLSQTFPNMPIFALVDWNPAGLAIMCTYKYGSISMGLESYRYACNVKWLGMRGDDLQLIPE 316
297836981 236 CVFITAKGYPDIATRFFLHRMSTTFPNLPILALVDWNPAGLAILCTFKFGSIGMGLEAYRYACNVKWIGLRGDDLNLIPD 315
302806102 205 SILITAKGYPDLASRVMLHKLHRSFPLLPILALVDWNPCGLGIICTYKFGSVGMGLEAPHYVCDVKWLGVSSEDLPRIPP 284
302808341 205 SILITAKGYPDLASRVMLHKLHRSFPLLPILALVDWNPCGLGIICTYKFGSVGMGLEAPHYVCDVKWLGVSSEDLPRITP 284
115474861 318 SAYQELKPRDLQIAKSLLSSKFLQD--KHRAELTLMLETGKRAEIEALYSHGFDFLGKYVARKIVQGDYI 385
30696943  316 ESLVPLKPKDSQIAKSLLSSKILQE--NYIEELSLMVQTGKRAEIEALYCHGYNYLGKYIATKIVQGKYI 383
242080619 317 SAFQVLKPRDLQTCTNYLRPQFHQE--SHRAELTLMVEKGKRADIEALYSHGFDYLGKYIARKIVQGDYI 384
297836981 316 ESLVPLKPKDSQIAKSLLSSKILQD--NYRDELSLMVQTGKRAEIEALYCHGYNYLGKYIATKIVQGKYI 383
302806102 285 EYFVELSARDRQLAKGLLSSAMLQNhpRYREELERMIQAGKRVEIEALYAHGYKSLSSYVAQKIVQMRYF 354
302808341 285 EYFVELSARDRQLAKGLISSAMLQNhpRYREELERMIQAGKRVEIEALYAHGYKSLSGYVAQKIVQMRYF 354
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap