Conserved Protein Domain Family
PLN00059

?
PLN00059: PLN00059 
PsbP domain-containing protein 1; Provisional
Statistics
?
PSSM-Id: 177690
View PSSM: PLN00059
Aligned: 2 rows
Threshold Bit Score: 547.819
Threshold Setting Gi: 297804700
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18414467    1 MASSAFAFPSYIITKGASTDSFKSTSLSSSRSLVTDFHLLFSRPISSGPKYQSAKSAKPESPVAINCLTDAKQVCAVGRR 80 
297804700   1 MASSAFAFPSYIITIGASTDSCKPTSLASSRSLVTDFHLLFSRPISSGPKHQSSKSAKPDSPVPRNSLTDAKQVCAVGRR 80 
18414467   81 KSMMMGLLMSGLIVSQANLPTAFASTPVFREYIDTFDGYSFKYPQNWIQVRGAGADIFFRDPVVLDENLSVEFSSPSSSN 160
297804700  81 RSMMMGLLMSGLMVSEANLPTAFASISVFREYIDTFDGYSFKYPQNWIQVRGAGADIFFRDPVVLDENLSVEFSSPSSSK 160
18414467  161 YTSLEDLGSPEEVGKRVLRQYLTEFMSTRLGVKRQANILSTSSRVADDGKLYYQVEVNIKSYANNNELAVMPQDRVARLE 240
297804700 161 YTSLEDLGSPEEVGKRVLRQYLTEFMSTRLGVKREANILSTSSRVADDGKLYYQVEVNIKSYANNNELAVMPQDRVPRLE 240
18414467  241 WNRRYLAVLGVENDRLYSIRLQTPEKVFLEEEKDLRRVMDSFRVEK 286
297804700 241 WNRRYLAVLGVENNRLYSIRLQTPEKVFLEEEKDLRRVMDSFRVEK 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap