Conserved Protein Domain Family
PLN00057

?
PLN00057: PLN00057 
proliferating cell nuclear antigen; Provisional
Statistics
?
PSSM-Id: 177688
View PSSM: PLN00057
Aligned: 28 rows
Threshold Bit Score: 342.011
Threshold Setting Gi: 161899221
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242060694   1 MLELRLVQAASLKNVLEALSvlDLSSEVNFEFSG-TGFELQAMDTSGAALVALLLRADAFNHYLCDRDLSMGLNLADMAN 79 
162605678   1 MLRAKLSSNSLLKKIVDAVK--DLISDANIEFTN-SGLSLQAMDSSHVSLVSLIIPPEEFEVYQCEKIQSLGINLNWFYK 77 
159490535   1 MFEARITQGAVLKKLVEALK--ELVTEGNFDVSS-TGLQLQAMDSSHVCLVSLALREDGFEHFRCDRNMAMGIHFQNLSK 77 
145347606   1 MFEARIKQGAVLKKVLDSVK--DLVTDANFEADPvEGFKLQAMDSSHVSLVSLKLHADGFEHYRCDRALTMGMNLANMAK 78 
219123915   1 MFEARLVEGKIFKQIIESIK--DLVTDANIECTE-EEIAIQCMDSAHVSLVDVTLSAAAFDHYRCDRNLSLGFNSANMSK 77 
223996962   1 MFEARLTQGKVFKQLIEALK--DLVQEANIDCTD-DEISIQAMDNSHVSLVAVSLRSGGFDHFRCDRPISLGFNAANMGK 77 
255074409   1 MFEARLVQGSLLKKVLESIK--DLVTDANFDCSN-NGFALQAMDSSHVSLVALLLRSDGFEHYRCDRNMTMGMNLSNMSK 77 
160331518   1 MLEARFSQSGQLKKIIESVK--DIVTDANLDCSP-LGLSLQAMDSSHVSLVSLFLESEGFEYFHCDKAVTLGIKLDSFYK 77 
302832690   1 MFEARITQGSVLKKLVEALK--ELVTEGNFDVSN-TGLSLQAMDSSHVCLVSLTLREDGFDHFRCDRNMAMGIHFGNLSK 77 
302832686   1 MFEARITQGSVLKKLVEALK--ELVTEGNFDVSN-TGLSLQAMDSSHVCLVSLTLREDGFDHFRCDRNMAMGIHFGNLSK 77 
242060694  80 VFRCANNDDILTIKVDGCPDTVMFVFESPKVGEISYFDLHFVDINrmpCEIPEIPESEYQAIVRMPSAKFMRICKKLSSV 159
162605678  78 ILKCATNEDSVEIIYKNNENFITFLFRNEANERSSEFQLRLLEIN---NETLGIPETIYSAVVTLTAVEYKRVCSEMLTI 154
159490535  78 ILKCAGNEDTITLKAEDNADQLTLMFESSNQDRISDFDLKLMSIE---SEHLGIPDQEYSAEIKMPSSEYQRIVRDLTSI 154
145347606  79 MLKCAGNDDAITMKADDAGDTVTFMFESPDQQKISDFELKLMDID---SEHLGIPETDYDVTLRMPSVEFQRICRDLASI 155
219123915  78 IFKMMNPDDVVVMKAEDNGDALTMMFESTKTETIADFELKLMEID---SEQLAIPETPYNCTIQMPSTEFQRIVRDLQVL 154
223996962  78 ILKCAGNDDVITLRAEDEGDSLALVFESPGQDRIADFELKLMDID---NEQLGIPDTEYKCTIQMPSAEFQRIIRDLQVL 154
255074409  78 MLKCAGNEDIITMKADDTGDVVTFMFESPDQDKISDFELKLMDID---SEHLGIPDTEYAATVKMPSSEFMRICRDLSSI 154
160331518  78 ILKCSSNEDSVTISWKDDPEILFFVFESHSSDRLSEFQLRLIQKS---SEQLGIPDTDYSAIVKLTSSEYRRICTDLSAL 154
302832690  78 ILKCAGNEDTITLKAEDNADQLTLMFEAPSQDRISDFDLKLMSIE---SEHLGIPDQDYSAEVKLPSSEYQRIVRDLTSI 154
302832686  78 ILKCAGNEDTITLKAEDNADQLTLMFEAPSQDRISDFDLKLMSIE---SEHLGIPDQDYSAEVKLPSSEYQRIVRDLTSI 154
242060694 160 GDredrdtVASISVDKERVDFFTSGKAGTSTIFCTVGKPKEPTliE-EPTLIEMKEKVSLSFDLRYVNSFSKMCTQSDqQ 238
162605678 155 GD------TVYLSISENTIKFEIEGEVGKGSISLKSHILEENS--VeDNNKTSDMEIIKMGFALRYLNTFAKAVPLSD-K 225
159490535 155 GD------TVLISATKEGIKFSTSGDVGTANVTLRHNTTPEKP--E-EQTIIDLKEPVALTFALRYLNNFAKATPLAP-V 224
145347606 156 GD------TVGISVTKDGVKFSTTGDIGEANITVRQNSEDDKD----KMIAIELGAPVSLTFALRYLNSFTKATPLCD-Q 224
219123915 155 GD------TCQISCTKEGVRFSVTGNIGTGNVLIRSNAAAEKE--D-DRVVIEMQEPVELTFALRYLNFFTKATPLSG-H 224
223996962 155 GD------TCTISCTKEGVKFSVSGDLGSGNVLVRQNSAAEKD--E-EKVMIEMDEPVELTFALRYLNFFTKATSLGP-T 224
255074409 155 GD------TVTISVSKDGVKFSTTGDIGQANITCRQNTSVDKE----EQTIIELQEPVTLTFALRYLNSFTKATPLAP-T 223
160331518 155 GD------TVILEVSKEGIKFEVEGDIGKGSITLNQATKEQNI--G-EKVHVEVNEPVKMIFSMRYLNSFSKATPLCE-K 224
302832690 155 GD------TVLISATKEGIKFSTSGDVGTANITLRHNTTPEKP--E-EQTFIDLKEPVALTFALRYLNNFSKATPLAP-Q 224
302832686 155 GD------TVLISATKEGIKFSTSGDVGTANITLRHNTTPEKP--E-EQTFIDLKEPVALTFALRYLNNFSKATPLAP-Q 224
242060694 239 VTISLSPELPVLFEYKITEMGRIRYYVAPRIKLQNEVDG 277
162605678 226 VTLKMSKDVPLQLEFNFGIKSLLRYYLAPKVDH------ 258
159490535 225 VKLSLTKDLPIVVEYQIGELGAVKFYLAPKIDDEDQMGE 263
145347606 225 VIVRLSPNLPVVVQYAVTEVGYVSYFLAPKIEDDDAM-- 261
219123915 225 VIISMAPDIPVMIEYPISETGHIKFFLAPKIEEDAD--- 260
223996962 225 VILSMSPEVPVVVEYPIGETGHIKYYLAPKIDEDEED-- 261
255074409 224 VQLQMSKELPVVVQYLIADMGYVRYYLAPKIEDDETAEA 262
160331518 225 IKIKMAKEVPLQMEFNIDLIGYVRYYLAPKVDNEI---- 259
302832690 225 VKLSLTKDLPIVVEYQVGELGSVRFYLAPKIDDEDNMGS 263
302832686 225 VKLSLTKDLPIVVEYQVGELGSVRFYLAPKIDDEDNMGS 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap