Conserved Protein Domain Family
PLN00056

?
PLN00056: PLN00056 
photosystem Q(B) protein; Provisional
Statistics
?
PSSM-Id: 177687
View PSSM: PLN00056
Aligned: 5 rows
Threshold Bit Score: 570.532
Threshold Setting Gi: 255569246
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115457392   1 MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISG 80 
225449323   1 MTVILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISG 80 
255564430   1 MTAILERRESESLWGRFCNWITNTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPLVDIDGIREPVSRSLLYGNNIISG 80 
255569246   1 MTAILERRESKSLWGHFYNWITSTENRLYIGWFVVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPISGSLLYGNNIISG 80 
302824477   1 MTATLDRRENASLWGRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFITAFIAAPPVDIDGIREPVSGSLIYGNNIISG 80 
115457392  81 AIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI 160
225449323  81 AIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI 160
255564430  81 AIIPTSAAIGLHFYPIWEAASVDEWLHNGSPYELIVLHFLLGVACYMGHEWELSFCLGMRPWIAVAYSAPVAAATAVFLI 160
255569246  81 AIIPTSTAIGLHFYPIWEAGSVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFHLGMRPWIAVAYSALVAAATAVFLI 160
302824477  81 AIIPTSAAIGLHFYPIWEAASIDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI 160
115457392 161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG 240
225449323 161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG 240
255564430 161 YPIGQGSFSDGMPLGISSTFNFKIVFQAEHNILMHPFHMLGVASVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG 240
255569246 161 YPIGQGSFSDGMPL--------------XHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG 226
302824477 161 YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG 240
115457392 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
225449323 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
255564430 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNPNGFNFNQSVVDSQGRVINTWADI 320
255569246 227 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPV-------------------------VVDSQGRVINTWADI 281
302824477 241 QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADI 320
115457392 321 INRANLGmevmheRNAHNFPLDLAalevpSLNG 353
225449323 321 INRANLG------KSNPSVPGPVS-----DRAG 342
255564430 321 INRANLGmevmheRNTHNFPLDLAaveapSTNG 353
255569246 282 INRANLGmevmheRNAHNFPLDLAavealSTNG 314
302824477 321 INRANLGmevmheRNAHNFPLDLAsveapSLNG 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap