Conserved Protein Domain Family
PLN00055

?
PLN00055: PLN00055 
photosystem II reaction center protein H; Provisional
Statistics
?
PSSM-Id: 177686
View PSSM: PLN00055
Aligned: 14 rows
Threshold Bit Score: 82.1983
Threshold Setting Gi: 224015792
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168009233  1 MATQIIDDTPKTKGKRSGLGDILKPLNSEYGKVAPGWGTTPLMGVAMGLFAVFLVIILELYNSSVLLDGVPVS 73 
224155557  1 MATQSVEGSSRSGPRRTIVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISMN 73 
242057451  1 MATQTVEDSSRPKPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSVLLDGILTN 73 
224077018  1 -----------------IVGHLLKLLNSKYGKVALGWGTTPLMGVTMALFAVFIFIILKIYYSSVLLDGISMN 56 
224068012  1 ------QGSSRSGPRRTIVGDLLKSLNSEYGKVAPRWGTTPLMGVAMALFAIFLSIILEIYNSSILLDGISMN 67 
224104367  1 MATQSVEGSSRSGPRRTIVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILVIYNSSVLLDGISMN 73 
224104355  1 MATQSVEGSSRSGPRRTIVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISMN 73 
297838033  1 MATQTVEDSSRSGPRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISVN 73 
297840919  1 MATQTVEDSSRSGPRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISVN 73 
302824495  7 RTTNGKTNNTRIEPRRTVVGNSLKPPNSEYGRAAPGWGTTPVMGVAMALPAVLPAIISETYNSPVPADGVPVS 79 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap