Conserved Protein Domain Family
PLN00052

?
PLN00052: PLN00052 
prolyl 4-hydroxylase; Provisional
Statistics
?
PSSM-Id: 177683
View PSSM: PLN00052
Aligned: 2 rows
Threshold Bit Score: 645.185
Threshold Setting Gi: 115471029
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115471029  11 KRMRGALLALALLLTATAVVPLLLLGEAGDDgvgAVAAAPPFNASRVRAVSWRPRVFVYKGFLSDDECDHLVKLGKRKMQ 90 
242047772   1 MRLRGVLLVLALLLAATGVVPVLLLGEDGGD---VVAPAPPFNSSRVKAVSWQPRIFVYKGFLSDAECDHLVTLAKKKIQ 77 
115471029  91 RSMVADNKSGKSVMSEVRTSSGMFLDKRQDPVVSRIEKRIAAWTFLPEENAENIQILRYEHGQKYEPHFDYFHDKVNQAL 170
242047772  78 RSMVADNQSGKSVMSEVRTSSGMFLNKRQDPVVSRIEERIAAWTFLPQENAENMQILRYEHGQKYEPHFDYFHDKINQVR 157
115471029 171 GGHRYATVLMYLSTVEKGGETVFPNAEGWENQPKDDTFSECAQKGLAVKPVKGDTVLFFSLHIDGVPDPLSLHGSCPVIE 250
242047772 158 GGHRYATVLMYLSTVDKGGETVFPNAKGWESQPKDDTFSECAHQGLAVKPVKGDAVLFFSLHVDGVPDPLSLHGSCPVIQ 237
115471029 251 GEKWSAPKWIRIRSYEHPP-VSKVTEGCSDNSARCAKWAEAGECEKNPVYMVGAEGLPGNCRKSCGVCDS 319
242047772 238 GEKWSAPKWIHVRSYENPPvVPKDTRGCADKSEHCAEWAAAGECGKNPVYMVGAEGAPGQCRKSCNVCDS 307
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap