Conserved Protein Domain Family
PLN00051

?
PLN00051: PLN00051 
RNA-binding S4 domain-containing protein; Provisional
Statistics
?
PSSM-Id: 177682
View PSSM: PLN00051
Aligned: 11 rows
Threshold Bit Score: 387.192
Threshold Setting Gi: 145348001
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168015016   1 CRAAVLSRDEKNHLLLGVDKAHVDDVARILEQARTAADRWEVAHSAFLTPPVLNDALTAVRRLS--DVGVLVSGGYAQAE 78 
145348001  32 ISTPSAAPLDVEVILRHAEPEHRDVVKRAVERAERVRDRWTVETIEFLDPGALHSVENAVRAVCgdEVEVRAWGGFASAE 111
159465535  18 RMCTAAATAKGADALAWVDPLNRREVARVLEIAERATDRWDVVWTDFLTPPIVADSMAALQGRQ--DVICVPWGGYAQAE 95 
18404337   54 YSAEAIKGDVDFLLKGVGDQAVAKEVKQILEMARRASSKREVLHTDFLTPPIVKESVSLLEKFA--DVKIVAQGGYPEAE 131
224114944   2 CHVAQATKGEVVALKGVEDKSVIEEVKRILDMARRASLRREVLHTDFLTPPTLKESLHVLEKLA--DVKAIAQGGYPQAE 79 
225461477  55 HLAQAMKGDANSLLKGVADRSTIEAVKHILEMAKRASARREVLHTDFLTPPVLKESMIVLEKLA--DMKAVAQGGYPQAE 132
242054411  38 STAIAVAAARDSAVKGSVDRNSAEEVRNILDMAQRASQRRDVFHTNFLTPPIVKEAMLAVEKLA--DIKAVAQGGYPQAE 115
255081170  33 AAKGAAKRDASSGLLSGVHPESIAAVSAIAERAQAASDRWGTEVTEFLDPALAADARVVIDRMA--DCEARPWGGYDRAE 110
302832532  28 ILASALKGQGTDTALAWVDPANRRDVARVLEIAERAAQRWDVVWTDFLPPPIVADSMAALASRT--DIVCLPWGGYAQAE 105
303285910   1 --------------------------ASIAERAEAASDAWSVHVTPFLDPALAADALAVVGRMA--DVDARPWGGYDRAE 52 
297597609  39 ALSFAAAAAGDSAVKASLDRNAAEELRSILDMAQRASQRRDVFHTNFLTPPIVKECMLAIEKLA--DIKAVAQGGYPQAE 116
168015016  79 RCRLSVGHVETIEagsl-----eggNAgyPGAVAALSVSGNFMFESATHGDFLGSILGT-GVTRDKVGDIIMQGEKGAQI 152
145348001 112 RRRATIARADSVD------------EEeiRDTVRVLRVQGNFMFDAATHRDFLGAILGT-GIKREKVGDIVVTGERGADV 178
159465535  96 RCRLALGREELMEslr------sdpQQ--LDGVVALQVKGNFMFDPAKHPDFLGAILGTaGVVREKVGDILVQGESGAQI 167
18404337  132 RCRISIGHPDVLT------------SD--PDIVAALSITGNFGFQPCSHGDFLGAILGT-GISREKLGDILIQEEKGAQV 196
224114944  80 RCRLSVGHPETLT------------SD--PDIVAALSITGNFGFQLCSHGDFLGAILGT-GIARNKLGDIIVLGGKRAQV 144
225461477 133 RCRLSVGHSEVLT------------TA--PDIVAALRITGNFGFQSCSHGDFLGAILGT-GIAREKLGDIILQGEKGAQV 197
242054411 116 RCRISVGHPDFMT------------SN--PDVVAALSISGNFRLEPCSHGDFLGAILGT-GITREKVGDILLQGERGAQV 180
255081170 111 RVRLVIGRREVLDgdgddsfaaltdAT--NGCVALLQVSGNFMFDAADHRDFLGAALGA-GIERDRLGDILVQGERGAQI 187
302832532 106 RCRIALGREELMEplq------sdpQQ--LDGVAALQVKGNFMFDPAKHPDFLGAILGT-GVVRDKVGDILVQGEAGAQI 176
303285910  53 RVRLVIGRAEVLD------------AP--PACVSAYKLSGNFMFDAADHRDFLGAVLGT-GIERDRVGDILVQGERGAQV 117
297597609 117 RCRVSVGHPDCMT------------SN--PDVVAALSISGNFRLEPCSHGDFLGAILGT-GITRDKVGDILLQGERGAQV 181
168015016 153 LVVPELVEFFCS---SLVQVRNVAVQTSAIPLSALQVKAPRVDTFKSVEASLRVDALTSAGFRMSRSKLAELISSGEVRV 229
145348001 179 MVSPEMAEFLST---ALTSVRTVKVEAREVDASELKVPEPKVEDIFSSESSTRLDALGSAGFRMSRSKFVAHVESGDVKV 255
159465535 168 LVDPDLVEHFET---SLVQVRTVPVETRRIPLSELSVRPPRQEEFSSVEASMRLDAIASAGFRMSRTKIGDMIKAGDVRL 244
18404337  197 LIVPELVDFVVT---ALDKVGNVGVTCSKIPLLALEYEPPRTNSFKTVEASLRIDAVASAGFKISRSKLVDLISSKDVRV 273
224114944 145 LLVPDLVDYIVS---SLDKVGDVSVSCTPIPLHAIEYEPPRTKSFKTVEASLRVDALASAGFKISRSKLVDLISNKDVRV 221
225461477 198 LIVPELVDFLVS---SLEKVGNVSVSCTKMPLLALEYEEPRTTTFKTIELSLRVDALASAGFKLSRSKLVDLISNGDVRV 274
242054411 181 LVDPGLVDYLIS---TLEKVGKVGVSCTQIPLLALEYEPPRTNSFKTVESSLRVDALASAGFKISRTKLASLISSGDVRV 257
255081170 188 LATRPMAAFLSS---AMTSVRKVPVATSIAPLTDLRVPPPRVDTFASVEKSMRLDAVASAGFRMSRSKMSDLIAAGAVKV 264
302832532 177 LVDPELVEHFEM---SLVQVRTVPVEVRRIALSELSVRPPRQEEVSSVEASLRLDAIASAGFRMSRTKMGDLIKAGDVRL 253
303285910 118 LATPEMATFLSQarpALTSVRSVPVACAAAPLSDLRVPPPRVDAFNSVEASMRLDAIASAGFRMSRSKMSDLVTSGAVRV 197
297597609 182 LVDPELVDYLTS---TLEKVGKVGVSCTQIPLLALEYEPPRTKSFKTVESSLRVDALGSAGFKISRTKLASLISAGDVRV 258
168015016 230 NWKEVTKTSLTLKTGDVVSVRGKGRIQVGEIVMTKK-GRYAVELTRYL 276
145348001 256 NWKEVKKGRYDLSAGDVVSCRGKGRLEVVDIQPARKeGRFACNLRRYV 303
159465535 245 NWRPVTKPSVEVKEGDVISCSGKGRVEIKACEMTKK-EKYAVTMMRYV 291
18404337  274 NWATVTKNGTIVKTGDVVSVSGKGRLKIGEINETKK-GKFAVEIIRYL 320
224114944 222 NWTTITKNNTTLKTGDVVSVSGKGRLKIGEINTTRK-GKFAVELIHYL 268
225461477 275 NWTTVTKNGTTLKTGDVVSVSGKGRLKIGEINSTKK-GKYAVELIRFL 321
242054411 258 NWTPTTKNGVTLKSGDVVSVSGMGRLKIGEIVTTRK-GKYAVELIRYL 304
255081170 265 NWREGAKPKTECKSGDVISLRGKGRVEVGEVTTTKK-GSFNVQLTRYL 311
302832532 254 NWRPVTKTSVDVKAGDVISCAGKGRLEVRAVDVTRK-EKYLVTLLRYV 300
303285910 198 NWREGCKPKTVVATGDVISLRGKGRVEVGEVETTKK-GKFSVQLTRYL 244
297597609 259 NWSPVSKNGVTLKAGDVVSVSGMGRLKIGEIVTTRK-GKYAVELIRYL 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap