Conserved Protein Domain Family
PLN00050

?
PLN00050: PLN00050 
expansin A; Provisional
Statistics
?
PSSM-Id: 165628
View PSSM: PLN00050
Aligned: 2 rows
Threshold Bit Score: 463.351
Threshold Setting Gi: 224052849
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224052849   1 MECLGYTIVILLTMLKIVKGYGTGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEI 80 
255564788   1 MELLIYTIVALLSILRTVEGYGSGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACFEI 80 
224052849  81 KCVNDNIWCLRGSITVTATNFCPPNNALPNNDGGWCNPPQQHFDLSQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTI 160
255564788  81 KCVNDNKWCLPGSIIITATNFCPPNLALPNNNGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVQYRRVPCRKTGGIRFTI 160
224052849 161 NGHSYFNLVLITNVGGAGDVVAVSIKGTKSNWQAMSRNWGQNWQSNTYLNNQALSFKVTTSDGRTVVSNNVAPSNWAFGQ 240
255564788 161 NGHSYFNLVLITNVGGAGDIVAVSIKGSNTNWQAMSRNWGQNWQSSSYLNGQSLSFKVTTSDGRTVISNNAAPSNWAFGQ 240
224052849 241 TYTGRQF 247
255564788 241 TYTGMQF 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap