Conserved Protein Domain Family
PLN00049

?
PLN00049: PLN00049 
carboxyl-terminal processing protease; Provisional
Statistics
?
PSSM-Id: 177681
View PSSM: PLN00049
Aligned: 14 rows
Threshold Bit Score: 624.453
Threshold Setting Gi: 302833333
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159489592   1 AVTSEQLLFLEAWRAVDRAYVDKGFNGQSWFRVREAYLKKEPMEDRDQTYAAIRKLLASLDDPFTRFLEPARLARLRGDT 80 
168047145   1 -LTEENLLFLEAWRTVDRAYVDKSFNGQSWFRYREDALKKEPMKTREETYAAIRKMLATLDDPFTRFLEPEKFKSLQSGT 79 
145340580  11 AITENQMLYLEAWRAVDKAYVDKTFNGNNWFKLRERGLKTADLDDTEATYGTIREMLGKLGDPFTQFLEPEKYASVTDRT 90 
225433320 108 ALTEENLLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYIAIKKMLATLDDPFTRFLEPDKFKSLRSGT 187
224100001  15 ALSEENLLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYTAIRKMLATLDDPFTRFLEPEKFKSLRSGT 94 
255554320  18 ALSEENLLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNNREETYVAIRKMLATLDDPFTRFLEPEKFKSLRSGT 97 
255076773 111 AITANNLLFLEAWRAVDKAYVDKTFNGVSWFKYREETVKRTPMDSIDQTYDAIRAMLAKLDDPFTRFLEPEKYASLSEST 190
302807499   1 ALTEENLLFLEAWRTIDRAYVDKSFNGQSWFRYRENVLRNEPMNTREETYGAIRKMLATLDDPFTRFLEPEKFKSLVSGT 80 
302833333   3 AVSSEQLLFLEAWRAVDRAYVDKSFNGQSWFRVRETFLKKESFESRSQTYDAIRKLVASLDDPFTRFLEPSRLSELRRGT 82 
302796037   1 ALTEENLLFLEAWRTIDRAYVDKSFNGQSWFRYRENVLRNEPMNTREETYAAIRKMLATLDDPFTRFLEPEKFKSLVSGT 80 
159489592  81 eKSEVTGIGVEVSFTEEAGGPSQsVLKVVAPTEGGPSERAGVRPGDVIAAVDGKSTRGISLYEASDLLQGPAGSSLTLTL 160
168047145  80 -NGAVTGVGLEVGFNTSDSSTSNtDLVVVSPVSGGPAARAGVLPGDVITAIDGVPTHGMGLYDAARRLQGPVQSQVELTL 158
145340580  91 mKADVSGVGVEMGFGDDA------KVVVVAPTPGGPSAEAGVKAKDFIVAVDGAATRGKSLYEVADELQGPQGSKVTLTL 164
225433320 188 -QGALTGVGLSIGYPTGFDGSPA-GLLVISASPGGPASRAGILSGDVILTIDGTSTETMGIYDAAERLQGPEGSSVELTI 265
224100001  95 -KSAVTGVGLSIGYPTGSDGSPA-GLVVISAAPGGPANKAGIVSGDIILAINDTGTESMGIYEAADRLQGPEGSSVELTI 172
255554320  98 -KGALTGVGLSIGYPTGSDELPA-GLVVISAAPEGPASRAGIVSGDVILAIDDSSTERMGIYDAADRLQGPEGSSVKLTI 175
255076773 191 mSANITGVGVEMAYGESDA-----EIVVVAPTPGGPADEAGVRPADRITAVDGRPVAGLSLYEVADALQGPASSEVDVSL 265
302807499  81 -TGALTGVGLEVGFDANSSGLPD-ELVVVTPVAGGPAARAGIQPGDVILEIDGEKVGGLSLYDAAKKLQGPENSSVILTV 158
302833333  83 qKSSVTGVGLEVTFTEGSGLAGS-LLKVVTPAEGGPADRAGVRPGDVILAVDDKPTMGISLYEASDLLQGGAPHSVSRVr 161
302796037  81 -TGALTGVGLEVGFDANSSGLPD-ELVVVTPVAGGPAARAGIQPGDVILEIDGEKVGGLSLYDAAKKLQGPENSSVILTV 158
159489592 161 ---QTPGkdgklgaPREVQLVR--CKVVFRPVSYATCsg-------vsPSSGVGAGKEgGGKYIRVTTFNNSTVDGVVAA 228
168047145 159 lkkDATT-------PSTITVL---EKITLNPVTWRLC-----------EMKQNDGSAPlKLGYIRLSTFNQNSSSAVKKA 217
145340580 165 e--RDGK-------TRDVAVQR--KRYTVVPVTSATC-----------EVKGDK-----KIGYVKLSAFNQVSGAKTKEA 217
225433320 266 r--SGPE-------VKSLSLMR--ERVSLNPVKSRLC-----------KMPGLGKDSP-KIGYIKLASFNQNASGAVKEA 322
224100001 173 r--SGQE-------IKHLALTR--EKVSLNPVKSRLC-----------VIPGSGKDSP-RIGYIKLTTFNQNASGAIREA 229
255554320 176 r--SGPE-------TKHLALTR--EKVSLNPVKSRLC-----------EIPASGKDSP-RIGYIKLTTFNQNASGAVKEA 232
255076773 266 r--RGGE-------DVAVRITR--RSYALVPVRAQLC--------------SPAAGTGtKMEYVRLTTFNQLSGAKVAEA 320
302807499 159 lnrESRM-------ENTMTLTR--EKIVVNPVTWKLC-----------EVSSYQ-----KLGYIRLSTFNKNSVRAVQQA 213
302833333 162 ---RAPGppfllplTPLVHITRlsELVVIRPVSYALCsgvkpavglkgESGGPEGAGDvRVGYVRVSTFNSNTLEGVTSA 238
302796037 159 ldrESRM-------ENTMTLTR--EKIVVNPVTWKLC-----------EVSSYQ-----KLGYIRLSTFNQNSVRAVQQA 213
159489592 229 MKEGKAAGVDGLILDMRNNGGGSFPAGVQVAKLLLPGGD-IVLISDSNGVRDIYSADKSLNLDTTTPLSVWVNKGTGSAS 307
168047145 218 IETLQESGAAAFILDIRNNSGGLFPSGVEIAKMWLDKGV-IVYIADSMGVRDIYDTDGDSAISTKEPLAVLVNKGTASAS 296
145340580 218 LAALKADGVDVFVLDLRDNVGGLFPGALEIAKAFMNEGT-IVYIADSNGERDVFQADRT-ALDAATPLKLLVNKGTASAS 295
225433320 323 IESLRSNDVNAFVLDLRDNSGGLFPEGVEIAKIWLEKGV-IVYICDGRGIRDIYDTDGSSVVAASEPLAVLVNKGTASAS 401
224100001 230 INTLRSNNVNAFVLDLRDNSGGLFPEGIEIAKIWLDKGV-IVYICDSRGVRDIYDTDGSSAIATSEPLAVLVNKGTASAS 308
255554320 233 ISTLRSNNVDAFVLDLRDNSGGLFPEGIEIAKIWLDKGV-IVYICDSRGVRDIYDAEGSGAIATSEPLAVLVNKGTASAS 311
255076773 321 VRSGLENGADAFVLDLRSNSGGLFPGALEIANTFMRRGAgIVLIADSDGVRDVFETDGVKTLAPDAPLTLLVDKGTASAS 400
302807499 214 LEALHKSGASGYVLDIRNNGGGYFPAVIDIAKMWLDKGV-IVYIADNRGIRDIYEADGGSAIAPSEPLALLVNKGTASAS 292
302833333 239 LKDAQAAGADGLILDLRNNGGGLFPAGVQVAKLLMSGGD-IVLISDSAGVRDIYTADGTSSLDTRTPLSVWVNKGTASAS 317
302796037 214 LEALHKSGASGYVLDIRNNGGGYFPAVIDIAKMWLDKGV-IVYIADNRGIRDIYEADGGSAIAPSEPLALLVNKGTASAS 292
159489592 308 EVLAGALKDNGRGTIVGE-TTFGKGLIQTVVNLSDGSGLAVTVAKYQTPSGLDINKIGITPDIRISp--------ESLAV 378
168047145 297 EILAGALKDNKRAVILGE-PTFGKGRIQSVFQLSDGSGMAVTIARYETPAHINIDKVGITPDRPLP---------AVLPM 366
145340580 296 EVLSGALQDNKRAIVLGE-QTFGKGLIQTLVPLSDGSAVSVTVAQYRTPNGTDINKIGITPDAPLPlda---sgaDIVPS 371
225433320 402 EILAGALKDNKRAVLFGE-PTFGKGKIQSVFELSDGSGLAVTVARYETPAHIDIDKVGIAPDHPLP---------TPFPK 471
224100001 309 EILAGALKDNKRAVLFGE-PTFGKGKIQSVFQLSDGSGLAVTVARYETPDHTDIDKVGVIPDHPLP---------RTFPK 378
255554320 312 EILAGALKDNKRAVLFGE-RTFGKGKIQSVFQLSDGSGLAVTVARYETPGHTDIDKVGVIPDHPLP---------TSFPK 381
255076773 401 EVLAGALRDNKRAAILGDtATFGKGLIQTVVPLTDGSAVSVTVARYQTPSGADINKVGIRPDAPLPvvsgadgqeSALPT 480
302807499 293 EILAGAFKDNDRATVLGE-PTFGKGKIQSVFELSDGSGLVVTTARYQTPDKIDIDKVGVSPDRPLP---------EAIPR 362
302833333 318 EVLAGALKDSGRGVVVGE-NTFGKGLIQTVVELSDGSGLAITVAKYQTPAGLDINRVGITPDIRLPp--------DQLAS 388
302796037 293 EILAGAFKDNDRATVLGE-PTFGKGKIQSVFELSDGSGLVVTTARYQTPDKIDIDKVGVSPDRPLP---------EAIPR 362
159489592 379 GGDAVCRQLAEPAA-------PRIFG 397
168047145 367 DEEAFCRCIEDPNAdcn-vsfTSLFS 391
145340580 372 NAADFCAYAREAPE---------LFI 388
225433320 472 DAEGFCGCLMDPTSacy-lnrVQLFS 496
224100001 379 DEEGFCGCLQDPAStfy-vnrGQLFA 403
255554320 382 DEESFCGCLQDPLStcy-inrVQLFA 406
255076773 481 EPGAFCAVVAADEGv-----aKALFP 501
302807499 363 DGESFCKCLQGSGSqecriplSSLFK 388
302833333 389 GGSAVCEQLAGPAA-------PRVFG 407
302796037 363 DGESFCKCLQGSGSqecriplSSLFK 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap