Conserved Protein Domain Family
PLN00048

?
PLN00048: PLN00048 
photosystem I light harvesting chlorophyll a/b binding protein 3; Provisional
Statistics
?
PSSM-Id: 177680
View PSSM: PLN00048
Aligned: 18 rows
Threshold Bit Score: 209.323
Threshold Setting Gi: 297598774
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159486759   1 MMLTKSAQAAFSGKVARPAKANRARLVCRAEEKSIAKVDRSK------------DQLYvgASQSSLAYLDGSLPGDFGFD 68 
145355794   3 ARTLNTVTLASAPARATKRCAKRATVVVRAEGETEAEAAPAPvkkaarktddlaPLYVlgNSDQSLSYLDGSLPGDYGFD 82 
168065932   1 --------------------------------------GSQR------------NLIF--ASKQSLSYLDGTLPGDYGFD 28 
168046799   1 -----------------------------------IQGGSKR------------SLIF--ASKQSLSYLDGTLPGDYGFD 31 
168049224   1 --------------------------------------GSKR------------SLIF--ASKQSLSYLDGTLPGDYGFD 28 
168049170   1 --------------------MEARGPDRIADRMPPPPGGSKR------------SLIF--ASKQSLSYLDGTLPGDYGFD 46 
255074955  15 VKGARATFGSRAAFAAPSAKASKARFVCRAEGEAEAPKEEAPkavvkk-erkkdDLYMmgVSDQNMAYLDGTLPGDFGFD 93 
302824061  19 QLVFGNGIRVSSSSAALPSPRKLSRFVVRATSDKPATKA-NR------------QLWF--ASSQSLSYLDGTLPGDYGFD 83 
302816085  19 QLVFGNGIRVSSSSAALPSPRKVSRFVVRATSDKPATKA-NR------------QLWF--ASSQSLSYLDGTLPGDYGFD 83 
302851012   2 MLLNRSAQAAFSGKAARPAQANRARLVCRAEEKSIATVDRSK------------DQLYvgASQSSLAYLDGTLPGDFGFD 69 
159486759  69 PLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNgYWADPYTIF 148
145355794  83 PLGLSDPEGAGGFINPQWLAYSEVIHGRWAMLGVAGMVAPEVLGGLGIIPQETGLVWYKAGMIPAQGTYD-YWANPFTIF 161
168065932  29 PLGLMDPEGAGGFIDPQWLPYAEIINGRFAMLGAAGAIAPEVLGRIGLIPQETAIPWFQSGVIPPVGNYS-YWADPYTLF 107
168046799  32 PLGLMDPEGAGGFIDPQWLPYAEIINGRFAMLGAAGAIAPEILGRIGLIPQETAIPWFQSGVIPPVGNYS-YWADPYTLF 110
168049224  29 PLGLMDPEGAGGFIDPQWLPYAEIINGRFAMLGAAGAIAPEVLGRIGLIPQETAIPWFQSGVIPPVGNYS-YWADPYTLF 107
168049170  47 PLGLMDPEGAGGFIDPQWLPYAEIINGRFAMLGAAGAIAPEVLGRIGLIPQETAIPWFQSGVIPPVGNYS-YWADPYTLF 125
255074955  94 PLGMSDPEGAGGFVNPQWLAYSEVIHGRWAMLGVAGIVAPEILGGMGVIPESTGLVWFTSGAIPPQGTFD-YWANPMTIF 172
302824061  84 PLGLSDPAGAGNFMTPNWLSYAEIINGRYAMLGAAGAIAPEIFGKIGIIPQETAVVWFKTGVFPPAGTYN-YWADPYTLF 162
302816085  84 PLGLSDPAGAGNFMTPNWLSYAEIINGRYAMLGAAGAIAPEIFGKIGIIPQQTAVVWFKTGVFPPAGTYN-YWADPYTLF 162
302851012  70 PLGLLDPVNSGGFVEPKWLQYSEVIHGRWAMLGAAGCIAPEILGAAGLIPEKTNIVWYESGVIPPAGSYDgYWADPYTIF 149
159486759 149 FVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGpFFNLFNLGKTEaaMKELKLKEIKNGRLAMLAM 228
145355794 162 WINAALMNFAELRRAQDYWNPGSMGKQELIGWEKMLGGSGEPAYPGG-FFNIMGQGKSD--MAKMRVKEIKNGRLAMMAC 238
168065932 108 VLEMALMGFAEHRRAQDYYKPGSMGKQYFLGLEKFLGGSGNPAYPGGpIFNFLGFGKNEkeLQELKVKEVKNGRLAMMAV 187
168046799 111 VLELALMGFAEHRRAQDYYKPGSMGKQYFLGLEKFLGGSGNPAYPGGpIFNFLGFGKNEkeLKELKLKEIKNGRLAMMAV 190
168049224 108 VLEMALMGFAEHRRAQDYYKPGSMGKQYFLGLEKFLGGSGNPAYPGGpIFNFLGFGKNEkeLQELKVKEVKNGRLAMMAV 187
168049170 126 VLEMALMGFAEHRRAQDYYKPGSMGKQYFLGLEKFLGGSGNPAYPGGpIFNFLGFGKNEkeLQELKVKEVKNGRLAMMAV 205
255074955 173 WVNMCMMNFAEIKRGQDYWFPGSQAETPLLGWEKGFGGSGNPTYPGGkWFNPFNLGKDD--MASMQKKEVKNGRLAMMAF 250
302824061 163 FLEMALMGFAEHRRAQDFYKPGSMGKQYFLGFEKYLGGSGDPAYPGG-IFNPFGFGKDEksMRTLKIKEVKNGRLAMLAI 241
302816085 163 FLEMALMGFAEHRRAQDYYKPGSMGKQYFLGFEKYLGGSGDPAYPGG-IFNPFGFGKDEksMRTLKIKEVKNGRLAMLAI 241
302851012 150 FIEIVAMQFAELRRLQDFRYPGSMGKQYFLGLEKIFAGSGDPAYPGGpFFNLFNLGKTEaaMKELKLKEIKNGRLAMLAM 229
159486759 229 LGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFagRVS 267
145355794 239 FACGAQAVMTGEGPVKNLIDHVSDPFGHNLLVNF--QNI 275
168065932 188 LGYFTQAIFTGVGPFQNLLDHLADPVHNNVLTNL--KIH 224
168046799 191 LGYFIQAIFTGVGPFQNLLDHLADPVHNNVLTNL--KIH 227
168049224 188 LGYFTQAIFTGVGPFQNLLDHLADPVHNNVLTNL--KIH 224
168049170 206 LGYFTQAIFTGVGPFQNLLDHLADPVHNNVLTNL--KIH 242
255074955 251 LGCMVQAAVTGEGPWKNICDHVADPFGANMLANF--GAI 287
302824061 242 LGYFIQAPFTGVGPFQNLLDHLADPFANNILTNL--KVY 278
302816085 242 LGYFIQAPFTGVGPFQNLLDHLADPFANNILTNL--KVY 278
302851012 230 LGYGAQATLTREGPFQNLLDHLADPVNNNILTNFg-KAF 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap