Conserved Protein Domain Family
PLN00047

?
PLN00047: PLN00047 
photosystem II biogenesis protein Psb29; Provisional
Statistics
?
PSSM-Id: 177679
View PSSM: PLN00047
Aligned: 12 rows
Threshold Bit Score: 318.702
Threshold Setting Gi: 303286071
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255553917   1 MAAVTSVSFSAIAQSFTERKSVASWSRSFSSNFDsfrfpvggfschyvgvkASNSSSSRMLIHCMSTATDVPPTVSETKF 80 
115472755   1 MAAISSLPFAALRRAADCRPSTAAAAAGAGAGAVvl--------------sVRPRRGSRSVVRCVATAGDVPPTVAETKM 66 
18399513    3 ATAISSLSFPALGQSDKISNFASSRPLASAIRICtkfs----------rlsLNSRSTSKSLIHCMSNVTADVPPVSETKS 72 
159471025   1 MLVAKHFVAPSVAPRPKAAPA------------------------------PRSSLARKAVATPVLAATFKPPTVAETKA 50 
242050546   1 MAAISSLPFAALRGASEWRPSSTAAAVSGAVVLS-----------------ARSRRGSRSVVRCVATAGDVPPTVAETKL 63 
225447671   1 MAAVTSLSFSALGQS-SERKVPVPTTRSFASAFEafrfranf--yavgvrsSSSSSSSRMVVQCMSSVTDV-PTVSETKM 76 
224146717   1 MAAVTPVSFSAISQSSSDRRAFCTVARNLGFEGFrfrssfs----chyvgvRASNSTSRMVIHCMSTSTDVPPTVADTKL 76 
224124656   1 MTAITSLSFSAVNQSSSERNTFVSSLASRNLSFEgfrlrsvf--schyvgvKASNSTSRTAIHCMSTSTDVPPTVSETKS 78 
255075137   7 SAATCRVAPAVRGQRFNKRAAT-----------------------------VAPRAHNRRALAIQAAVDLNAVTLADTKR 57 
302852549   1 MLTTLQRSAPVAAAASRAKPTP-----------------------------VRLAKPGRAVAVRVLAANFTPPTVAETKA 51 
303286071   8 ASAVCRVTAPRTGAR------------------------------------RASKARATRGVAVRAAVDLNEVTVADTKQ 51 
297832696   3 ATAISSLSLPALGQSDKISNFAPCRPLASTIRICtkss----------rhsLTSRSTSRSLIHCMSTVTDVPP-VSETKS 71 
255553917  81 NFLNSYKKPIPSIYNTVLQELIVQQHLMRYKRSYRYDPVFALGFVTVYDQLMQGYPSDEDREAIFQAYINALNEEPEQYR 160
115472755  67 NFLKSYKRPILSIYSTVLQELLVQQHLMRYKTTYQYDAVFALGFVTVYDQLMEGYPSNEDRDAIFKAYITALNEDPEQYR 146
18399513   73 KFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYRYDPVFALGFVTVYDQLMEGYPSDQDRDAIFKAYIEALNEDPKQYR 152
159471025  51 KFLSGYNKPIASIYSTVLQELLVQQHFMRYSKNYQYNPIFALGFVSVYEQILESL-SAEERGAIFKAYVDALGEDADKYK 129
242050546  64 NFLKSYKRPIPSIYSTVLQELLVQQHLMRYKRTYQYDPVFGLGFVTVYDQLMEGYPSNEDRDSIFRAYITALNEDPTQYR 143
225447671  77 NFLKNYKRPIPSIYNTLLQELMVQQHLMRYKRTYRYDAVFALGFVTVYDQLMDGYPSDEDRDIIFQVYIKALREDPEQYR 156
224146717  77 NFLKAYKRPIPSIYNTVLQELIVQQHLMKYKKTFRYDPVFGLGFVTVYDQLMEGYPSDEDREAIFQAYIKALEEDPEQYR 156
224124656  79 NFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYLYDPVFGLGLVTVYDQLMEGYPSDEDREAIFQAYIKALKEDPEQYR 158
255075137  58 KFVESYPYPIPSIWSVAVNELLANQHFVRYSTRYSYSKLSSLGFVSVYDQLFEGFPSDEEKAKIFDCFVEALGEDPEKCR 137
302852549  52 KFFEGYSKPIASIYSTVLQELLVQQHFMRYSKDYVYNEIFALGFVSVYEQILESLP-QSERDAIFVSYVKALGEDPEAYK 130
303286071  52 KFLKSYPYPIPSIWSVALQELLVTQHFVRYSKKYSYSKLSSLGFVSVYDQLFEGFPSEEEKNTIFECFVKALEEDPATVR 131
297832696  72 NFLKAYKRPIPSIYNTVLQELIVQQHLMRYKKTYRYDPVFALGFVTVYDQLMEGYPSDQDRDAIFKAYIEALNEDPKQYR 151
255553917 161 IDAKKLEDWARSQTPSSLVDFSSKEGEVE------------------------------------GILKDIAERAGN-GS 203
115472755 147 ADAQKMEEWARSQNGNSLVEFSSKDGEIE------------------------------------AILKDISERAQGkGS 190
18399513  153 IDAQKMEEWARSQTSASLVDFSSKEGDIE------------------------------------AVLKDIAGRAGSkEG 196
159471025 130 RDASALEQAANGLTPESLTP-NADGNEVQ------------------------------------KALASISSASAA-GA 171
242050546 144 ADALKMEEWARSQNASSLVDFSSRDGEIE------------------------------------AILKDISERAKGkGN 187
225447671 157 KDAQMLEEWARSQTASSLVEFSSKEGEVE------------------------------------GILKDIAERAGGkGS 200
224146717 157 IDAKKLEEWARAQTPSSLVDFSSREGEIE------------------------------------GTLKDIAERVAS-GN 199
224124656 159 IDAKKLEEWARAQTHSSLVDFSSKEGEIE------------------------------------GILKGIAERAAS-GN 201
255075137 138 KDAAELAKFAKEAGGVDALLASPVLAEIK------------------------------------S--------NGEaNK 173
302852549 131 RDSERVEKAAGALSGPDALVPDAEGSDVQtsayiwayhqrrgemrmpwrtrtwgqgssslgvcsyGKALDAIKAASAaDA 210
303286071 132 KDAAELASFAEGASGVDGVLASPIFAQMK------------------------------------SLVAD--------GK 167
297832696 152 IDAQKMEEWARSQTSASLVDFSSRQGEIE------------------------------------ALLKDIAGRAASkEG 195
255553917 204 FSYSRFFAIGLFRLLELSNSTEPTVLEKLCAALNINKRGVDRDLDVYRNLLSKLVQAKELLKEYVDREKKKQEERAS--- 280
115472755 191 FSYSRFFAVGLFRLLELANATEPTILDKLCAALNINKRSVDRDLDVYRNILSKLVQAKELLKEYVEREKKKREERSE--- 267
18399513  197 FSYSRFFAVGLFRLLELASATDPTVLDKLCASLNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAQ--- 273
159471025 172 FSYNKFVAIGLFRLLELSGAKEPSALEKLVKAVGVKPEAVNRDLLMYKGVLSKLAAAKELMREFVEREKRKQAERDA--- 248
242050546 188 FSYSRFFAVGLFRLLELANATEPTVLDKLCTALNVSKRSVDRDLDVYRNILSKLVQAKELLKEYVDREKKKREERSE--- 264
225447671 201 FSYSRFFAIGLFRLLELANATEPTILEKLCAAFNISKRSVDRDLDVYRNLLTKLVQAKELLKEYVDREKKKREERVE--- 277
224146717 200 FSYSRFFAVGLFRLLELSNASEPTVLEKLCSALNINKRSVDRDLDVYRGLLSKLVQARELLKEYVDREKKKQEERAE--- 276
224124656 202 FSYSRFFAVGLFRLLELSNASEPTVLEKLCSALNINKRSVDRDLDVYRGLLSKLVQAKELLKEYVDREKKKQEERAE--- 278
255075137 174 FAYSRYDAIGLFRMLELGGATEPAALEKLADAAGLKLKKVNGDLGMYKGLLSKLAAAKELQKEIFEREKRKTAERLA--- 250
302852549 211 FSYNKFVAIGLFRLLELTGAKEPAALERLVKSVGIKPEAVNRDLLMYKGVLSKLAAAKEMMREFVEREKRRGGGQMRvlp 290
303286071 168 FAYSRYDAIGLFRLLELAKATEPAALEKLAESSGLQARSIH----------------------WFPYDRVGVVNADP--- 222
297832696 196 FSYSRFFAVGLFRLLELASATDPTVLDKLCASLNINKKSVDRDLDVYRNLLSKLVQAKELLREYVEREKKKQGERAE--- 272
255553917 281 ---------------------SQKANEAVKSCLGEALHVS 299
115472755 268 ---------------------TPKSNEAVTKFDGSLNSMR 286
18399513  274 ---------------------SQKANETISKCLGDTLYNP 292
159471025 249 ---------------------AKAAKAAGTESSPAQVQA- 266
242050546 265 ---------------------TPKPNEAVTKFDGNLYSMR 283
225447671 278 ---------------------SQKANEAITKCLGEYEYTG 296
224146717 277 ---------------------SQKASETVTKCLGEPQFVG 295
224124656 279 ---------------------SQKANEMVAKCLGDPQVVG 297
255075137 251 ---------------------KKEAANDATA--------- 260
302852549 291 lpssqyhmitnrgigdlishmASEDTLTCASCEGWFEQAG 330
303286071     ----------------------------------------    
297832696 273 ---------------------SQKANETISKCLGDTLYNP 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap