Conserved Protein Domain Family
PLN00044

?
PLN00044: PLN00044 
multi-copper oxidase-related protein; Provisional
Statistics
?
PSSM-Id: 165622
View PSSM: PLN00044
Aligned: 2 rows
Threshold Bit Score: 1117.05
Threshold Setting Gi: 242035743
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242035743   1 MPPLLLLLLLAAalalapapARSGDPYAYYDWEVSYVSAQPLG--VKQKVIGINGQFPGPPLNVTTNWNVVVNVRNALDE 78 
115433954  12 ILGILFLVLLRW--------AGAGDPYAYYEWEVSYVWGAPLGgvKKQEAIGINGQLPGPALNVTTNWNLVVNVRNGLDE 83 
242035743  79 PLLLTWNGVQQRKTAWQDGVLGTNCAIPAGWNWTYTFQVKDQVGSFFYFPSTPLHRAAGGYGAITINNRDVIPIPFGFPD 158
115433954  84 PLLLTWHGVQQRKSPWQDGVGGTNCGIPPGWNWTYQFQVKDQVGSFFYAPSTALHRAAGGYGAITINNRDVIPLPFPLPD 163
242035743 159 -GDITLFIGDWYNRGHRELRRALDGGTLLGAPDGVLVNGFGPYQYNQSVVPPGIVYERINVEPGKTYRFRVHNVGVSTSL 237
115433954 164 gGDITLFLADWYARDHRALRRALDAGDPLGPPDGVLINALGPYRYNDTLVPPGVTYERINVDPGRTYRLRVHNVGVATSL 243
242035743 238 NFRIQNHNLLLVETEGSYTSQQNYTNLDIHVSQSYSFLVTMDQNASTDYYVVASARFVDAAvvDKLTGVAILHYSNSQGP 317
115433954 244 NFRIQGHNLLLVEAEGSYTSQQNYTNMDIHVGQSYSFLLTMDQNASTDYYVVASARFVPDA--DKLTGVAILHYSNSQGP 321
242035743 318 ASGPLPDPPNDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVYLLQSRAPELIDGKLRSTLNEISYIAPS 397
115433954 322 PSGSLPDAPDDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVYLLQSMPPELIDGQMRATLNGISYIAPS 401
242035743 398 TPLVLAQIFNVPGVFKLDFPNHPMNRLPKVDTSIINGTYKGFMEIIFQNNATNVQSYHLDGYAFFVVGMDYGLWTENSRG 477
115433954 402 TPLMLAQLFNVPGVYKLDFPNRPMNRLPKLDTSIINGTYKGFMEIIFQNNATSVQSYHLDGYAFFVVGMDYGLWTDNSRG 481
242035743 478 TYNKWDGVARSTIQVFPGAWTAILVFLDNAGIWNLRVQNLDTWYLGQEVYINVVNPEDNSST----IPDNAIFCGALSSL 553
115433954 482 TYNKWDGVARSTIQVFPGAWTAVLVFLDNAGIWNLRVENLDAWYLGQEVYISVVNPEDSSNKtvlpLPDNAIFCGALSSL 561
242035743 554 QKEQSHRFQYSEATPV-PLWgktvSLLVLLACFALW 588
115433954 562 QKEQSHRFQYSEASQItQLW----KMVFFMAWLALW 593
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap