Conserved Protein Domain Family
PLN00043

?
PLN00043: PLN00043 
elongation factor 1-alpha; Provisional
Statistics
?
PSSM-Id: 165621
View PSSM: PLN00043
Aligned: 40 rows
Threshold Bit Score: 861.319
Threshold Setting Gi: 302770006
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18390827    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
168000955   1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
168000927   1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
168021343   1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
168021329   1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
168021331   1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
168021333   1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
168027930   1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
302770000   1 MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRTIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
302774324   1 MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRTIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKF 80 
18390827   81 ETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
168000955  81 ETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
168000927  81 ETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
168021343  81 ETMKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
168021329  81 ETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
168021331  81 ETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
168021333  81 ETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
168027930  81 ETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
302770000  81 ETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
302774324  81 ETNRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP 160
18390827  161 KYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240
168000955 161 KYSKARFDEISKEVSTYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDNVSEPKRPSDKPLRLPLQD 240
168000927 161 KYSKARFDEISKEVSAYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLEWYKGPTLLEALDNVSEPKRPSDKPLRLPLQD 240
168021343 161 KYSKARYEEIVKEVSAYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDNVSEPKRPSDKPLRLPLQD 240
168021329 161 KYSKARFEEISKEVSAYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDNVSEPKRPSDKPLRLPLQD 240
168021331 161 KYSKARFEEISKEVSAYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDNVSEPKRPSDKPLRLPLQD 240
168021333 161 KYSKARFEEISKEVSAYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDNVSEPKRPSDKPLRLPLQD 240
168027930 161 KYSSARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLSWYKGPTLLEALDNVSEPKRPSDKPLRLPLQD 240
302770000 161 KYSKARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLEWYKGPTLLEALDQVTEPKRPSDKPLRLPLQD 240
302774324 161 KYSKARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLEWYKGPTLLEALDQVTEPKRPSDKPLRLPLQD 240
18390827  241 VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDD 320
168000955 241 VYKIGGIGTVPVGRVETGIIRPGMLVCFAPTGLTTEVKSVEMHHESMPEAHPGDNVGFNVKNVAVKDLKRGYVASDSKND 320
168000927 241 VYKIGGIGTVPVGRVETGVIRPGMLVCFAPTGLTTEVKSVEMHHESMPEAHPGDNVGFNVKNVAVKDLKRGYVASDSKND 320
168021343 241 VYKIGGIGTVPVGRVETGIIRPGMLVCFAPTGLTTEVKSVEMHHESMPEAHPGDNVGFNVKNVAVKDLKRGYVASDSKND 320
168021329 241 VYKIGGIGTVPVGRVETGIIRPGMLVCFAPTGLTTEVKSVEMHHESMPEAHPGDNVGFNVKNVAVKDLKRGYVASDSKND 320
168021331 241 VYKIGGIGTVPVGRVETGIIRPGMLVCFAPTGLTTEVKSVEMHHESMPEAHPGDNVGFNVKNVAVKDLKRGYVASDSKND 320
168021333 241 VYKIGGIGTVPVGRVETGIIRPGMLVCFAPTGLTTEVKSVEMHHESMPEAHPGDNVGFNVKNVAVKDLKRGYVASDSKND 320
168027930 241 VYKIGGIGTVPVGRVETGIIRPGMLVCFAPTGLTTEVKSVEMHHESMPEAHPGDNVGFNVKNVAVKDLKRGYVASDSKND 320
302770000 241 VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGFVASDSKND 320
302774324 241 VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGFVASDSKND 320
18390827  321 PAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVV 400
168000955 321 PAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTV 400
168000927 321 PAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTV 400
168021343 321 PAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTV 400
168021329 321 PAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTV 400
168021331 321 PAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTV 400
168021333 321 PAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTV 400
168027930 321 PAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMTV 400
302770000 321 PAKEAASFTSQVIIMNHPGQIGNGYTPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVV 400
302774324 321 PAKEAASFTSQVIIMNHPGQIGNGYTPVLDCHTSHIAVKFAEILTKVDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVV 400
18390827  401 ETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTGAKVTKAAVKKG 447
168000955 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
168000927 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
168021343 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
168021329 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
168021331 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
168021333 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
168027930 401 ETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
302770000 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
302774324 401 ETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPTGAKVTKAAAKKK 447
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap