Conserved Protein Domain Family
PLN00042

?
PLN00042: PLN00042 
photosystem II oxygen-evolving enhancer protein 2; Provisional
Statistics
?
PSSM-Id: 177676
View PSSM: PLN00042
Aligned: 21 rows
Threshold Bit Score: 385.313
Threshold Setting Gi: 302820299
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115470529   1 MASTSCFLHQSTARVAARVA--------SPSPATRTHLLVCRA--------QKQDDADVSRRAALALLAGAtAAVGVKVA 64 
168025747   1 MACAACVSSGLVVKSSTSLAsaksaingASVTVAAPRVAPVAVrslvvrasKGEEGETFSRRAALALVAGV-LAAGAKVG 79 
168022403   1 MSCTAALSSGFAVKCA-SLAwaksgisgASVTFAAPSVSTVVArssvvrscRGDESETVSRRAALALVAGV-VAASARIA 78 
168037541   1 MACIAAVSSGLVVKGA-SLAsaksgvsgASVTVAAPCVGPVASrsvtvrasKGEESEIVSRRTALALVAGV-VAAGARIA 78 
145356775   1 ---------MFTLSTTLAHAavkanvkaTRKSQSRRGAVKVAA----------QAPDASSRREAMSLIAGA--TTLAMSK 59 
168002491   1 -----------------------------------------------------EESETVSRRAALALVAGV-IAAGAKVG 26 
255561128   1 MATTGCFLHHPALTSTPNRLssv--sqrQVSNTTKPTQFICRAstk--qplQEEDLSLVSRRLALTVLIGA-AAVGSKVS 75 
255087532   1 MAAITSASSAVVARPTFAGKtealraraVAPVSAKRASVVTLA-----------SADETSRRAALSVFTAA--GAAAAAK 67 
302820299   1 --------------------------------------------------mADEEEQGVSRRLALALAAGA-LVATGKVS 29 
302822639   1 --------------------------------------------------mADEEEQGVSRRLALALAAGA-LVATGKVS 29 
115470529  65 PAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIINPTTKKTITEFGS 144
168025747  80 SANAAYGESANVFGAPKISTGFTPFAGNGFTLDVPSKWNPSKEQEFPGTVVRFEDNFDATNNLFVSITPATKGSITEYGP 159
168022403  79 PANAAYGESANVFGAPKQSTGFSPFTGDGFSLDIPSKWNPSKEKEFPGTVLRFEDNFDATNNLFVSITPASKGSITEYGS 158
168037541  79 PANAAYGESANVFGAPKQSTGFNPYSGNGFSLEIPSKWNPSKEKEFPGTVLRYEDNFDSTTNLFVSITPATKGSITEYGP 158
145356775  60 PAFAAYGDSANVFGGVSNPTGFVPYAGDGFAFLLPSKYNPSKERPFPNTECYFEDNFDQVTNISVIAEKAEKGSIDAYGK 139
168002491  27 SANAAYGESANVFGAPKKQTGFTPFIGNGFSLDVPSKWNPSKEKEFPGTVVRFEDNFDATNNLFVSVTPAKKGSISEYGP 106
255561128  76 PADAAYGEAANVFGKPKTNTDFMPYNGDGFQLSVPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVMITPTDKKSITDFGT 155
255087532  68 PSFAAYGDSANIWGSTTNSSGFIPYSGDGYAFLLPSKYNPSKERPFPGQDAYFEDNFDAVSNISILVEKCGKSKIEDFGS 147
302820299  30 TASAAYGEAANVFGSPKQQSGFTTLTGDGFKLDVPSKWNPSKELEFPGTLLRYEDNFDQKSNLAVMVIPTDKKSITDYGS 109
302822639  30 TASAAYGEAANVFGSPKQQSGFTTLTGDGFKLDVPSKWNPSKELEFPGTLLRYEDNFDQKSNLAVMVIPTDKKSITDYGS 109
115470529 145 PEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATANILESSAPVVGGKQYYSVTVLTRTADGDEGGKHQLITATVNDGKL 224
168025747 160 PEKFLDEVSFLFGKQAYSGKTASEGGFVNNAVATAAVLEANSVDINGRPYYKLSVLTRTADGDEGGKHQLIAATVKDGQL 239
168022403 159 PEKFLDEVSYLFGKQAYNGKTASEGGFQNNSVATAAILEAKSVELKGRPYYKLSVLTRTADGDEGGKHQLIAATVKDGNL 238
168037541 159 PEKFLDEVSYLFGKQAYSGKTASEGGFENNAVATAAVLEANSMEVNGRPYYKLSVLTRTADGDEGGKHQLIAATVKDGNL 238
145356775 140 PEQFLEKLGYLLGVQSYAGQTRSEGGFAANKVSTAAVLDVYTRENKGKTYYQYEILTRTADGDEGGRHQLITATVSDGNL 219
168002491 107 PEKFLDEVSFLFGKQAYEGKTASEGGFQNNAVATAAVLDAASVEVNGRPYYKLSVLTRTADGDEGGKHQLIAATVKDGNL 186
255561128 156 PEEFLAKVDYLLGKQAYFGKTASEGGFDPNAVATANILDSSTQVVGGKEYYFLSVLTRTADGDEGGKHQLITAAVKDGKL 235
255087532 148 PESYLEKIGYLLGQQVYSGETRSEGGFAANKVSSAAVLDVFTKSNKGKTYYYYEVLTRTADGDEGGRHQLIAATVSDGTL 227
302820299 110 PEDFLSAYSYLLGKQAYAGKTVSEGGFDPNAVATAAVLQSKTKDINGKKYYDLDVLTRTADGDEGGTHQLIVASINNGKL 189
302822639 110 PEEFLSAYSYLLGKQAYAGKTVSEGGFDPNAVATAAVLQSKTKDINGKKYYDLDVLTRTADGDEGGTHQLIVASINNGKL 189
115470529 225 YICKAQAGDKRWFKGARKFVESAASSFSVA 254
168025747 240 YLFKAQAGDKRWFKGVKKFVEGAWNTFNVA 269
168022403 239 YMLKAQAGDKRWFKGVKKFVEGAWNTFTVA 268
168037541 239 YLFKAQAGDKRWFKGVKKFVEGSWNSFTVA 268
145356775 220 YIMKLQSGDKRWFKGQERDLRTAMNSFTVA 249
168002491 187 YLFKAQAGDKRWFKGVKKFVEGAWNSFNVA 216
255561128 236 YICKAQAGDKRWFKGARKFVESAASSFSVA 265
255087532 228 YTMKLQSGDKRWFKGQERDLKQTWSSFTVA 257
302820299 190 YLLKAQAGDKRWFKGAQKFVKGVAESFSLA 219
302822639 190 YLLKAQAGDKRWFKGAQKFVKGVAESFSLA 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap