Conserved Protein Domain Family
PLN00039

?
PLN00039: PLN00039 
photosystem II reaction center Psb28 protein; Provisional
Statistics
?
PSSM-Id: 177673
View PSSM: PLN00039
Aligned: 16 rows
Threshold Bit Score: 198.825
Threshold Setting Gi: 224002100
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224002100   1 AQIQFVKGLEEKVVPGIKLTRARDGSSGIATFNFNNPNVFDAStSSQGEITGMFLVDEEGEMRTSDVNAKFLNGKPQSIE 80 
145354881  21 TSIQFVKGQNETSVPEVKLTRSKDGSNGTAFFIFAEPDVFENG---QGDITGMFLNDEEGEMSTVDVNAKFINGKPSGIE 97 
168026840   5 PVIQFIRGVDERVVPEIRLTRSPNGTNGKAIFVFDQPSVFDAS-RELGDITGLYLVDEEGTLSTVEVSAKFLNGKPSKIE 83 
168059549   5 PVLQFIRGVDERSVPEIRLTRSPDGTNGKAIFVFDQPSVFDSS-RELGDITGLYMLDEEGVLSTVDVSAKFLNGKPSKIE 83 
224070060   5 PAIQFVQGADEQTVPDVRLTKSRDGTNGMAIFTFDQPSVFDSS-AEVGDITGFYMIDEEGILQSVDVNAKFVNGKPERIE 83 
225437969  69 PTIQFIQGTDEQTVPDVRLTQSRDGTNGMAIFKFEQPSVFDSS-GEVGDITGFYMIDEEGVLQSVDVSAKFINGKPSGIE 147
255571176  68 PSIQFIQGTDEQTIPDVRLTKSRDGTNGMAIFTFDEPSVFDSS-AELGDITGFYMIDEEGVLQSVDVSAKFVNGKPARIE 146
255079050   7 TSIQFVKGTNETSVPDVKLTRSKDGTNGTAFFWFSEPDVFEAT-ELEGEITGMFLIDQEGELSTVDVNAKFLNGKPQGIE 85 
302766731   4 PSIQFIRGVDELVVPDISLTRSQDQRNGVATFVFDQPSVFDSS-REMGEITGIYMIDDEGVLQSVDVSAKFVNGKPAKIE 82 
302792389   4 PSIQFIRGVDELVVPDISLTRSQDQRNGVATFVFDQPSVFDSS-REMGEITGIYMIDDEGVLQSVDVSAKFVNGKPAKIE 82 
224002100  81 SVLVMQSPEEWDRFMRFMERYGEANGLGFTKA 112
145354881  98 ARYVMKTERDWDRFMRFMARYAEDNGLGFAKK 129
168026840  84 SQYVMRNTTEWDRFMRFMERYAKENQLGFVKS 115
168059549  84 SQYIMRNTTEWDRFMRFMERYAKENQLGFVKS 115
224070060  84 AKYIMRTPREWDRFMRFMERYANANGLQFVKK 115
225437969 148 AKYVMRSPREWDRFMRFMERYSNENGLQFVKK 179
255571176 147 AKYVMRSPREWDRFMRFMERYANANGLQFVKS 178
255079050  86 ATYVMKSTNEWNRFMRFMERYAEDNGLGFAAK 117
302766731  83 AKYVMRNIGEWDRFMRFMERYAAENNLGFVKK 114
302792389  83 AKYVMRNIGEWDRFMRFMERYAAENNLGFVKK 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap