Conserved Protein Domain Family
PLN00037

?
PLN00037: PLN00037 
photosystem II oxygen-evolving enhancer protein 1; Provisional
Statistics
?
PSSM-Id: 177671
View PSSM: PLN00037
Aligned: 26 rows
Threshold Bit Score: 412.302
Threshold Setting Gi: 219119085
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219119085   1 MKFTAACSIALAASASAFAPIPSvsRTTDLSMSLQKDL-------ANVGKVAAAGALAFGLATAPANA------LTKSQI 67 
159473144   1 ------MALRAAQS-----------AKAGVRAARPNRAtavvckaQKVGQAAAAAALATAMVAGSANA------LTFDEI 57 
145356482   1 -----MASLTQSAVFGKKFTTVK--ASTKRATKTTVARasmndfaEKVSKASVALGVAGAVLAQSAGA------VTYDEL 67 
255087772   1 -----MAAISASMSLSAVAKAKTvrASKRTAVKCSAAKpafvekvEKAGKAALSGLAALTLAAGSAQA------VTYDEL 69 
303289126   1 -MAAISASMSLSAVANKRAAVRS---TKRSAVKCAANKeafvakvEKAGKAALSGLAASALLASSAGA------VTYDEL 70 
302846662   1 ------------------mavsmraAQTVKAAGVSRAArpvranvVCKAQKVEFGQAAAAVVAASALVagsanaLTYDEL 62 
302825884   1 -----------------------------------------------------------------------pkrLTYDEV 9  
302825880  20 DASAGSSASLRPVSVSKAFGLRSngGGARLTCSMEDIVkr----aTDVGKVAVATAAATLLVAGTAAAnp--krLTYDEV 93 
302822661  20 DASAGSSASLRPVSVSKAFGLRSngGGARLTCSMEDIVkr----aTDVGKVAVATAAATLLVAGTAAAnp--krLTYDEV 93 
302820319  20 DASAGSSASLRPVSVSKAFGLRSngGGARLTCSMEDIVkr----aTDVGKVAVATAAATLLVAGTAAAnp--krLTYDEV 93 
219119085  68 NELSYLQVKGTGLANRCPEVVGEDSITP---KGGQRLVDMCIEPKAWAVEEEiGKAGRTEKKFVNSKVMTRQTYTLDGIE 144
159473144  58 QGLTYLQVKGSGIANTCPVLESGTTNLKelkAGSYKLENFCIEPTSFTVKEE-SQFKGGETEFVKTKLMTRLTYTLDAMS 136
145356482  68 QGLTYLQVKGTGLANTCPVVEGGVSGKEi-kAGDYALERFCMEPTSFTVKEE-SQFKQGESEFSKTRLMTRLTYTLDGMT 145
255087772  70 QGLTYLQVKGTGLANTCPVVETGGSGSSi-kGGDYALEKFCMEPTSFTVKEE-SAFKAGESEFVKTKLMTRLTYTLDGMT 147
303289126  71 QGLTYLQVKGTGLANTCPVVDGGESSKSi-kAGDYALEKFCMEPTSFTVKED-SAFKAGESEFTKTKLMTRLTYTLDGMT 148
302846662  63 QGLTYLQVKGTGIANTCPVLEKGSTDLSelsAGTYKLENFCIEPTSFTVKEE-SVFKGGETEFVKTKLMTRLTYTLDAMS 141
302825884  10 QAQTYLEVKGSGTANQCPILSGGDEGFKf-kPGSYSVKKFCLEPTSFTVKKE-SPFKGGGDQYVDTKLMTRLTYTLDEIE 87 
302825880  94 QAQTYLEVKGSGTANQCPILSGGDEGFKf-kPGSYSVKKFCLEPTSFTVKKE-SPFKGGGDQYVDTKLMTRLTYTLDEIE 171
302822661  94 QAQTYLEVKGSGTANQCPILSGGDEGFKf-kPGSYSVKKFCLEPTSFTVKKE-SPFKGGGDQYVDTKLMTRLTYTLDEIE 171
302820319  94 QAQTYLEVKGSGTANQCPILSGGDGGFKf-kPGSYSVKKFCLEPTSFTVKKE-SPFKGGGDQYVDTKLMTRLTYTLDEIE 171
219119085 145 GALKS-EGGSIVFQEQEGIDYAATTVQLPGGERVPFLFTVKDLVAKGNGGSFkpgfqmGGDFNTPSYRTGLFLDPKGRGG 223
159473144 137 GSFKVgSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDNI------KGDFLVPSYRGSSFLDPKGRGG 210
145356482 146 GSFKVgSDGSVNVQENDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQF------GGDFVVPSYRGSSFLDPKGRGG 219
255087772 148 GSFKVgSDGSVAVQERDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQF------GGDFVVPSYRGSSFLDPKGRGG 221
303289126 149 GSFKVgSDGSVAIQERDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQF------GGDFVVPSYRGSSFLDPKGRGG 222
302846662 142 GTLKVgSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDNI------KGDFVVPSYRGSSFLDPKGRGG 215
302825884  88 ADLSVdEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGF------SGSFLVPSYRGSSFLDPKGRGG 161
302825880 172 ADLSVdEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGF------SGSFLVPSYRGSSFLDPKGRGG 245
302822661 172 ADLSVdEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGF------SGSFLVPSYRGSSFLDPKGRGG 245
302820319 172 ADLSVdEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGF------SGSFLVPSYRGSSFLDPKGRGG 245
219119085 224 TTGYDMAVALPGLQSGEEgdDDLFKENNKTFDITTGRIEMEVNKVNAEEQEIGGVFVATQLSDTDMGSKVPKKVLTKGIF 303
159473144 211 STGYDNAVALPA--RADA--EELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLW 286
145356482 220 STGYDNAVALPA--RADS--EELQKENQKNTAALKGSAVFNVAKYDPATGEIAGVFESIQPSDTDLGAKVPKDVKITGLW 295
255087772 222 STGYDNAVALPA--KSDA--DELLKENNKNVAALKGSAVFNVAKYDEVTGEIAGVFESIQPSDTDLGSKAPKDVKITGLW 297
303289126 223 STGYDNAVALPA--KSDA--DELLKENNKNVAALKGSAVFNVAKYDPVTGEVAGVFESIQPSDTDLGSKAPKDVKITGLW 298
302846662 216 STGYDNAVALPA--RADA--EELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKITGLW 291
302825884 162 STGYDNAVALPAGGAGDE--EELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIW 239
302825880 246 STGYDNAVALPAGGAGDE--EELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIW 323
302822661 246 STGYDNAVALPAGGAGDE--EELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIW 323
302820319 246 STGYDNAVALPAGGAGDE--EELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIW 323
219119085 304 YARVE 308
159473144 287 YAQLK 291
145356482 296 YANLG 300
255087772 298 YAQLA 302
303289126 299 YAQLQ 303
302846662 292 YGQLS 296
302825884 240 CAQLD 244
302825880 324 YAQLD 328
302822661 324 YAQLD 328
302820319 324 YAQLD 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap