Conserved Protein Domain Family
PLN00036

?
PLN00036: PLN00036 
40S ribosomal protein S4; Provisional
Statistics
?
PSSM-Id: 177670
View PSSM: PLN00036
Aligned: 41 rows
Threshold Bit Score: 321.278
Threshold Setting Gi: 161899455
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168057168   1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYREVVAIVMQRLISIDGKVRTDK 80 
219110737   1 MPRGPKKHLKRLNAPSHWNLGKMTGVFAPKPSPGPHKERECLPICIALRDRLKYALTNKECMQICMERCVKVDGKVRTDH 80 
159466042   1 MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKEVQSILMQRLVKVDGKVRTDH 80 
145355247   1 MARGLKKHLKRLNAPKHWMLDKLGGVFAPKPSPGPHKSRECLPLCLILRNRLKYALTYKEVTTILMQRVVKVDGKIRMDK 80 
162606302   1 MSRGIKKHYKRLNAPKKWLLNKLGGIWAPRSSSGPHKKQNSIPLVIVIRNKLKYSTNQRESLNILKKNEIYVDGKVRADK 80 
223996813   1 MARGPKKHLKRLNAPRHWNLGKMGGVWAPKPSAGPHKQRECLPVAIILRERLKYALTGKECQQICMERCVKIDGKVRTDH 80 
255077197   1 MPRGPKKHLKRLNAPKHWMLDKLGGVFAPKPSAGPHKTRECLPLCLILRNRLKYALTYKEVTTILMQRLVKVDGKTRVDK 80 
160331849   1 MAHGIKKHLKRLRAPKRWKLTKLGGIWAPNPKSGPHKKFESFPLILILRNRLKYALNNQEAVQILQQRSIKVDKKIRTEK 80 
302846722   1 MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKEVQSILMQRLVKVDGKVRTDH 80 
302805125   1 MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYREVVAIVMQKLISIDGKVRTDK 80 
168057168  81 CYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAKYKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTV 160
219110737  81 NYPTGFMDVVELEKSGDRFRILFDSKGRFVLHRINREESQYKLCRINKIYIGSKKIPVAVTHDGRTIRYPDPDAKVNDTV 160
159466042  81 TYPTGFMDVISMEKTDENFRLVLDTKGRFVVHRISKEEAAYKLCRVRKVEFGKGGVPYVITHDGRTIRYPDPEIKANDSI 160
145355247  81 CYPCGIMDVVSIEKSDEHFRLIYDNKGRFVVHRIEAIEAQYKLCKVKSKKLGDKGVPCVGLHDGRTIRYPDPLIKEGDSV 160
162606302  81 NFPAGVMDVISIKTTKENYRVLYDNVGHFFLHRITIKESMFKLCKVIRVSIGSKGIPYIVTHDGRTIRFPNLLIKSNDSI 160
223996813  81 NYPAGFMDVVELEKSGDRFRLLYDTKGRFVLHRIQKDEAEYKLCRIQKGYMSAKKVPVAVTHDGRTLRFPDPDVAVNDTV 160
255077197  81 CYPAGFMDVVSIDKTDEHFRLIYDAKGRFVVHRISSTEAQYKLCKVKTKRLGDKGVPCVNLHDGRTIRYPDPVINESDTV 160
160331849  81 NYPAGLMDIISIEKTEENFRLLVDTFGRFILHRIEEKESMFKLCKVTKSTKGQRGIPYIVTHDGRTIRFPDPFIKTNDTI 160
302846722  81 TYPTGFMDVISIEKTDEHFRLVLDTKGRFVVHRISKEEAAYKLCRVRKVQFGKGGVPYVATHDGRTVRYPDPEVKANDSV 160
302805125  81 CYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINSEEAKFKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTI 160
168057168 161 KINLETGKVVEFIKFDIGNIVMVTGGRNRGRIGVIQHREKHKGSFDIIHVTDSTGNQFATRMGNVFTIGQGTKPWITLPR 240
219110737 161 KVDLATGKMSDIIKFELGAMVTLVRGRNAGRVGTLMHIERHLNSFDIVTVKDAKGHTFATRLHNVFVIGNGTTPQISLPK 240
159466042 161 MLDIETGKIKEFVKNDVGALVMVTGGHNAGRVGKIVHKEKHKGSFEIVHIEDAAGNRFATRLTNIFVIGKEGKPLISLPK 240
145355247 161 MVDIATNKITDFVKFDVGALCMITGGRNAGRVGVIQRREKHIGSFEIVHLKDAAGQEFATRATNVFAIGTGSKPMISLPK 240
162606302 161 VLDLLNNKVIDFIKFSIGSLCVVIKGSNIGRIGVFINTIGGQGSDSIVCLKDFNGSSFSTQTKNLFVIGKGTKSFISLPR 240
223996813 161 KVNIATGKMSDIYKFEIGAMIMVTKGHNAGRVGTLEHVEKHDGSFSIVTIKDKKGNTFATRQANVFVIGSGDHPQVTLPK 240
255077197 161 MVDIATNKITDHIKYDAGALVMITGGRNRGRVGVIQRREKHKGSVEVVHVKDAGGHEFATRSSNTFVIGEGNKPMISLPK 240
160331849 161 LFDLSEKKIIDFIKFEVGSLCIITGGPNVGRIGIVLQQGKNFLEEEMIKLKDAKGSEFSTKFSFIFVIGKGKKSFISLPK 240
302846722 161 MLDIETGKIKEYVKNDVGALVMVTGGHNAGRVGKIVHKEKHKGSFEIVHIEDAAGNRFATRLTNIFVIGKEGKPLISLPK 240
302805125 161 KIDLETGKIKEFIKFDVGNLVMVTGGRNRGRVGTIQHREKHKGSFDIIHIKDSVGQDFATRMGNVFTIGQGTKPWVSLPK 240
168057168 241 GKGIKLSIVEEAKKRKAVTNQ 261
219110737 241 GRGIKKSIIEERAEAEAAGRI 261
159466042 241 GKGIRLTIIQEQKKRYEAGQA 261
145355247 241 GKGIKLSIVDERH-------- 253
162606302 241 FRGLRTLTKSLEHDNYN---- 257
223996813 241 GRGIKKTILQERAEAEARGDL 261
255077197 241 GKGLRLTIVEELERRKEA--- 258
160331849 241 GKGIREIQFD----------- 250
302846722 241 GKGIRLTIIQEQKKRYEAASA 261
302805125 241 GKGIKLSIVEEARKRVKG--- 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap