Conserved Protein Domain Family
PLN00035

?
PLN00035: PLN00035 
histone H4; Provisional
Statistics
?
PSSM-Id: 177669
View PSSM: PLN00035
Aligned: 159 rows
Threshold Bit Score: 119.552
Threshold Setting Gi: 161899353
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15231283    1 MSGRGKG---GKGLGKGGAKRHRKVLRDNIQG-ITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEH 76 
162606014   2 TVGKGKV---GKGLGKRGTKRHKKVLRDSIQG-ITKPAIRRLARRGGVKRISGLIYEETKIVLKLFLENVVKDAVTYTEH 77 
159480048   1 MSGIDKClgpGRGIGKGG-KRHRKVLRESINTaLTQGSIRRLARRGGVKRLSGLVYNEIRSVLRGFLEALVRDTITYTEH 79 
224008100   1 MSGRGKG---GKGLGKGGAKRHRKVLRDNIQG-ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEH 76 
224009752   1 MSGRGKG---GKGLGKGGAKRHRKVLRDNIQG-ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEH 76 
224004146   1 MSGRGKG---GKGLGKGGAKRHRKVLRDNIQG-ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEH 76 
224004326   1 MSGRGKG---GKGLGKGGAKRHRKVLRDNIQG-ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEH 76 
224005038   1 MSGRGKG---GKGLGKGGAKRHRKVLRDNIQG-ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEH 76 
160331031   2 VVGTGKG---GKGLGKGGTKRHRKVLRDNIQG-ITKPAIRRLARRGGVKRISGLIYEETRNVLKIFLESVVKDAVTYTEH 77 
302833151   1 -SERGKG---SKGMGKGGTKRLHKILRDNIQG-ISKPAIRRLARRGGVKRISGLIYEEVRSVLRSILEDILRDALTYTEH 75 
15231283   77 ARRKTVTAMDVVYALKRQGRTLYGFGG 103
162606014  78 ARRKTVTAMDVIYALKRQGRTIYGFGY 104
159480048  80 ARRQHVKLMDVMYALKRQGRTLYGFGV 106
224008100  77 ARRKTVTAMDVVYALKRQGKTLYGFGG 103
224009752  77 ARRKTVTAMDVVYALKRQGKTLYGFGG 103
224004146  77 ARRKTVTAMDVVYALKRQGKTLYGFGG 103
224004326  77 ARRKTVTAMDVVYALKRQGKTLYGFGG 103
224005038  77 ARRKTVTAMDVVYALKRQGKTLYGFGG 103
160331031  78 ARRKTVTPMDVVYALKRQGRTLYGFGS 104
302833151  76 SHRVTVHVMDVIHALKRQGRVLYGL-- 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap