Conserved Protein Domain Family
PLN00028

?
PLN00028: PLN00028 
nitrate transmembrane transporter; Provisional
Statistics
?
PSSM-Id: 177665
View PSSM: PLN00028
Aligned: 70 rows
Threshold Bit Score: 497.912
Threshold Setting Gi: 219130395
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15241440    5 QRNTKPPSFSDSTIPVDSD--GRATVFRPFSLSSPHSRAFHLAWLSLFSCFFSTFSIPPLVPVISSDLNLSASTVSAAGI 82 
225452384  21 QSESMESKESQFALPVDSE--HKATVFHPFSLAAPHMRAFHLAWLSLFATFFSTFAIPPLLPIIREDLKLTDTDIGNAGI 98 
242053291   8 eencygvgGAEASGGVDAE--GRATDLRPLALSSPHTQAFHLAWLSLFACFFAAFAAPPILPALRPALVLAPSDAAAAAV 85 
219112463  13 GEPVEWKQYSTYSIKTDPDqdDKATEIKLCSFARPHMRAFHCSWWCFFIAFFIWFAIAPLLSEIRDDIGITKQDVWTSSI 92 
219115383  14 gepseWKKYSSYHIKTDPDqdDKASEIRLCSFARPHMRAFHCAWWCFFIAFFIWFAIAPLLSEIRDDIGITKQDVWTSSI 93 
219120390  45 HLSSILPRYSNYNVRVDKDrsDRALEIRLLSSQRPHMRAFYCATISFFAAFGMWFSVSPFLGIIGEELSLSRSQLWLSTI 124
219129386   1 --------YERYDVTVDDAeaDRATEIKIFSIRRPHMRAFHVAWFSFFWAFTIWFAPAPLLKEIQKTLGLTRKEIWTSSI 72 
223995449   1 -MASWDSKYETYACRVDQSqeDRSVEIPLFSMARPHMRAFHFAWLTFFFVFLAWFSITPLLSEVQKSLDLTKEQLWTSSI 79 
223998258   7 GQATEIKKYQEYFVKVDPDqdDKATEIKLLSFKRPHMRAFHCSWMCFFTAFFIWFAIAPLMSEVQLTLGLSKQQIWTSNI 86 
224004506   7 SGQAEIKKYQEYFIKVDPDqdDKATEIKLLSFKRPHMRAFHCSWICFFTAFFIWFAIAPLMSEVQLTLGLSKQQIWTSNI 86 
15241440   83 ASFAGSIFSRLAMGPLCDLIGPRTSSAILSFLTAPVILSASLVS-SPTSFILVRFFVGFSLANFVANQYWMSSMFSGNVI 161
225452384  99 ASFMGSIFSRLAMGTACDVFGPRIACATLSLLTVPIVFSACFIS-TPQSFIVLRFLIGFSLANFISNQFWMSSMFSGCVV 177
242053291  86 GSLSATLVGRLAMGPACDLLGPRRASGLASLLAALAVAVTAVTAsSPTGFVALRFVAGLSLANFVANQHWMSGIFAPSAV 165
219112463  93 VGVGGTILMRFIMGPMCDKYGARISLDSVVRFYSY--------G-IATGLAVLRLFIGVAGSTFVPCQYWSSRMFSKEVV 163
219115383  94 VGVGGTILMRFVMGPMCDKYGARVLFMLILCFASIPTACTGFVN-SATGLAILRLFIGVAGATFVPCQYWSSRMFTKEVV 172
219120390 125 CSDVATILSRFVVGPACDFYGARLPMAVVLILSSIPTALTGTVR-SFAGLCAVRFGTGIAGSAFVMAQYWMGQMFCQEII 203
219129386  73 TNDITAIFLRILIGPLCDVYGARLPMAAVLVLASIPTAMVGLIQ-SAAGLSVTRFFIGIAGSSFVMAQFWPSRMFTRELA 151
223995449  80 FSVAGGLVTRCLAGPFCDIYGARLISAAILFVCGIPTMFTGLVN-SSVGLSVLRLIVGIGGSAFVTCQYWTSTTFTMEVA 158
223998258  87 CSVAGTIVMRFINGPLCDKYGARILMGVVLFAASIPCALTGLVN-DATSLSILRFFIGLGGSTFVMCQYWTSRMFTKEVA 165
224004506  87 CSVAGTIVMRFINGPLCDKYGARILMGVVLFAASIPCALTGLVN-DATSLSILRFFIGLGGSTFVMCQYWTSRMFTKEVA 165
15241440  162 GLANGVSAGWANVGAGISQLLM-PLIYSTIAEF--LPRAVA------WRVSFV-FPAIFQVTTAVLVLLYG-QDTPHGNr 230
225452384 178 GLANGVAAGWANVGAGATQLIM-PLIFAFITSFn-VPAFTA------WRIAFV-VPALFQAVTALMVLFYG-QDLPDGN- 246
242053291 166 GLANAVAAGWANVGSAAAQLVM-PLAYELVLRLg-VPITVA------WRVTYLiLPCALLITTGLAVLAFPyDDLPHGA- 236
219112463 164 GTANALCGGWGNLGGGVTQLVMgSALFPLFKIFfdGDSEMA------WRTVCV-IPAIIAMASGIIVYRIS-DDAPKGN- 234
219115383 173 GTANALCGGWGNLGGGVTQLVMgSALFPLFKVFfdGDSEKA------WRTVCV-VPAIVAMASGIMVYRIS-DDAPKGN- 243
219120390 204 GTANAIVAGWGNSGGGVIQVLLgTGLYPFLKEAsgNDEA--------WRFVFV-VPAVFAIAVAIVIVKSS-DDAPLGY- 272
219129386 152 GTANGIVGGWGNLGGAFTQLLMgTILFPAFRNLydGDSEKA------WRVICV-IPAAVAFLWGIAVPWIS-DDAPMGN- 222
223995449 159 GTANALAAGWGNLGGGVAQILVgTILFPLFKLIykSAGTAMdpaelsWRTCCI-IPGLICSCFTFVVLRHS-DDSPKGN- 235
223998258 166 GTANAIVGGWGNLGGGVTQLVMgSVLFPLFKLg--MSAEQA------WRTVCV-VPAIVGMIAGIVTVKVS-DDAPKGN- 234
224004506 166 GTANAIVGGWGNLGGGVTQLVMgSVLFPLFKLg--MSAEQA------WRTVCV-VPAIVGMIAGIVTVKVS-DDAPKGN- 234
15241440  231 kNSNQNKLTIPEeeevlvveedeRSSFVEILIGGLGNYRAWILALLYGYSYGVELTTDNVIAGYFYERFGVNLEAAGTIA 310
225452384 247 -YKRRQRSSTKP-----------RESVFKVLLHGLSNYRGWVLGLTYGYCFGVELTVDNIIAQYFYDRFNLNIETAGAIA 314
242053291 237 ---GVGGGAKTT-----------GKSFWKVVRGGVSNYRAWVLALTYGYCYGVELIMENVAADFFRKRFHLPMEAAGAAA 302
219112463 235 -YVDMKKHGTMP-----------EVSAAASFRSGALNLNTWVLFVQYACCFGVELTMNNAAALYFKDEFGQSTESAAAIA 302
219115383 244 -YDEMKKHGTMP-----------EVSAAASFRSGALNLNTWVLFIQYACCFGVELTMNNAAALYFKDEFGQSTESAAAIA 311
219120390 273 -YREMKRNGTMD-------------LHHSTMMSGTTSRNAWLLAVAYACSFGVEITFNNAASLYFRDEFGASTSSAAALA 338
219129386 223 -YGEMKKRGAMD-----------RILMTTALRQGAVVNT-WILYVQYACSFGVELVMNNATVLYYTDEFGLSTEDAAALG 289
223995449 236 -YRKRKRLGLMQ-----------KDSAMHHLKAAVCDHNTWLLLIQYGCCFGVELTTTNAAALYFKEEFELSTESAAAIA 303
223998258 235 -YSEMKKNGTMP-----------EVSAAASFRGGAMNLNTWLLFFQYACCFGVELTMNNAAASYFKTKFELTTESAAAIA 302
224004506 235 -YSEMKKNGTMP-----------EVSAAASFRGGAMNFNTWLLFFQYACCFGVELTMNNAAASYFKTKFELTTESAAAIA 302
15241440  311 ASFGISNIASRPAGGMISDALGKRFGMRGRLWGLWIVQSVAGLLCVLLGRVN-----SLWGSILVMWVFSVFVQAASGLV 385
225452384 315 ASFGVVNFFSRPAGGVISDEMGRRFGIRGRLWSLWIVQTVAGLLCILLGRVN-----TLGASILVICAFSVFVQAASGLT 389
242053291 303 AYFGAMNAVARPTDGVTSDAIARLFGIRGRLWLLWAVQTAGAALCVLVGRMGaveapSLAATMAVMVACAASMQAASGLT 382
219112463 303 SIFGWMNLFARGLGGFTSDKANAKMGMRGRLWVQTIFLALEGALVLVFAQTG-----SLVGAIVVMIFFSLNVQAAEGAT 377
219115383 312 SIFGWMNLFARGLGGFASDKANAKMGMRGRIWVQTIFLALEGALVLVFAQTG-----SLGAAIAVMVFFSLNVQAAEGAT 386
219120390 339 SIFGLTNLYARACGGIVSDLMNQHWGMWGRLSWGCIAIVIQGASIIAFGYAD-----TLTSAVPLLILLSSCVNATEGAI 413
219129386 290 FIYGSMNLFARGMGGYLSDQLNLKFGLRGRLWLQTCLLVVEGIVIIIFPFAD-----TLRGAIVTMCIFSIFTQAAEGAI 364
223995449 304 STFGWMNLFARGLGGFLSDVSNAYRGMRGRLVWQFVCFALEGAFICAFSKAN-----SLAGAIIALMTFSLFVQGAEGST 378
223998258 303 SIFGWMNLFARGLGGFASDKANAKMGMRGRLAWQTLCLVMEGVMVFIFANTN-----SLGVAIFIMVIFSSFVQAAEGST 377
224004506 303 SIFGWMNLFARGLGGFVSDKANAKMGMRGRLAWQTLCLVMEGVMVFIFANTN-----SLGLAIFIMVIFSSFVQAAEGST 377
15241440  386 FGVVPFVSTRSLGVVAGITGSGGTVGAVVTQFLLFSGDDVRKQRSISLMGLMTFVFALSVTSIYFPQWGGMCCGPSSSSE 465
225452384 390 FGVVPFVSKRSLGVISGMTGSGGTVGAVVTQLLLFSGSKYSKETSISLMGVMMIVCSIPVTFIYFPQWGGMFCGPS---- 465
242053291 383 FGIVPFVSKRSLGVVSGMTASGGAVGAIVTNRLFFSGSRYTIEEAISLTGAASLVCTLPLALVHFPRHGGMLCGPTDVGA 462
219112463 378 YGIVPYVDPASTGSISGIVGAGGNTGAVCFGLGFR---QLSYEKAFNIMGYSILASAFMSALINIKGHASMFWG------ 448
219115383 387 YGIVPYVDPASTGSISGIVGAGGNTGAVCFGLGFR---QLSYEKAFNIMGYSILASALMSVFINIKGHAGLFWGKDDVVQ 463
219120390 414 FGIVPYVNPAVAGSIAGIVGLGGNVGGVCFALAFH---SLSYLQAFKVMGAVAMASSAIFFFVDIPGHATLTSRSK---- 486
219129386 365 FGVVPYVTKLYSGSVSGLVGAGGNAGSVIFGLGFR---SLSYRQAFIMMGCIVIASSGLSAFINIPLYAGLLWGKDNHSV 441
223995449 379 FGIVPYLNPNLTGTVAGIVGAGGSAGAVVFSIMFR---QMDYRIAFFYMGVATTCSSVLSIFIWIVGYEGLFFKRRMPQL 455
223998258 378 YGIVPYVNPPCTGSISGIVGAGGNVGAVCFGLGFR---QLETKQAFVLMASCIVVSGVISAFVCIKGHAGLFTGQD---- 450
224004506 378 YGIVPYVNPPCTGSISGIVGAGGNVGAVCFGLGFR---QLETKQAFVLMASCIVVSGVISALIFIKGHAGLFTGQDSDEV 454
15241440  466 E-----EDISRGLLVEDEDEEGkVVSGSLRPVC 493
225452384 466 ---------YDSDWVDEEYRLI-E--------- 479
242053291 463 GagdgdAEYDDNDSAGDYMLLK----------- 484
219112463 449 --------------KDEIIEKG-ILAVPMPEAE 466
219115383 464 ------KATLTVPAQEEEIEA------------ 478
219120390 487 ------SLKAINARRETTERLP-MDQDEDRIQE 512
219129386 442 I-------------------------------- 442
223995449 456 Rak--qENTKTSPQTDASLSHE-IELPSERLGR 485
223998258 451 ------SDEVIAAYKGQKTATT-LQVPEQDAEA 476
224004506 455 ------IAAYKKAGGAVPTTLQ-VPEPDAEVAA 480
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap