Conserved Protein Domain Family
PLN00027

?
PLN00027: PLN00027 
aquaporin TIP; Provisional
Statistics
?
PSSM-Id: 177664
View PSSM: PLN00027
Aligned: 26 rows
Threshold Bit Score: 294.772
Threshold Setting Gi: 297600324
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15231569    1 MPTRNIAIGGVQEEVyHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANI 80 
15228041    1 MPIRNIAIGRPDEAT-RPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANI 79 
242036929   1 MPISRIAVGTHHEVY-HPGALKAALAEFISTLIFVFAGQGSGMAFSKLTSGGATTPSGLIAAAVAHAFALFVAVSVGANI 79 
225441155   1 MPIRNIAFGRPEEAT-RPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVAASLAHAFALFVAVSVGANI 79 
225436454   1 MPFLRIAIGQPQETY-QPDALKAALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIAEALGHGLGLFVAVSGACNI 79 
224118422   5 IIIERITIGRVEDDF-HSNAFKAALAEFISTLIFVFAGQGSTMAYNKLTSNAPTSPAGLIAVALAHAFGLFVGVAVSANI 83 
255556846   1 MPIRNIAVGHPHEAT-QPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGAATPSGLVAAAIAHAFALFVAVSVGANI 79 
255565467   1 MPITRIAIGLPQHDIlQSDALKAALAEFFSTAIFVFAGEGSSMAFSKLTDDGSSTPAAIIMASLAHAFGLFVGVSTAANI 80 
297823489   1 MPIRNIAVGRPDEAT-RPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAALAHAFGLFVAVSVGANI 79 
297818190   1 MPTRNIAIGGVQEEVyHPNALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLVAAALAHAFGLFVAVSVGANI 80 
15231569   81 SGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTV 160
15228041   80 SGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTV 159
242036929  80 SGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGLATGTFGLT-GVSVWEAVVMEIVMTFGLVYTV 158
225441155  80 SGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTV 159
225436454  80 SGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLLLKFCTHGMTTSAFAISSGVTVWNAFVLEIVMTFGLVYTV 159
224118422  84 SGGHVNPAVTFGAFIGGNISLLRGILYWIAQLLGSTVACLLLKYTTHHMTVSVFTLSPGVTVWNAFVFEIVMTFALVYTV 163
255556846  80 SGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTV 159
255565467  81 SGGHCNPAVTFGAFLGGNISLLRGILYWIAQLLGSTVACLLLKFSTHGMTTSAFALSSGVNVWNAFVFEIVMTFGLVYTV 160
297823489  80 SGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTV 159
297818190  81 SGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTV 160
15231569  161 YATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFI 240
15228041  160 YATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFI 239
242036929 159 YATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFI 238
225441155 160 YATAIDPKKGNLGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWTWTNHWVYWAGPLIGGGLAGLVYEVFFI 239
225436454 160 YATAIDPRKGNVGIIAPLAIGLIVAANILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGLVYETVFI 239
224118422 164 YATAIDPKKGDVGVIAPLAIGFVLGANILVGGAFEGAALNPAVPFGPALVSWNWYHHWVYWAGPLIGGGLAGIVYELIFM 243
255556846 160 YATAVDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLVGGGLAGLVYEFFFI 239
255565467 161 YATAIDPKKSEVGIIAPLAIGFVVGANILAGGAFEGASMNPAVSFGPALVSWDWTNHWVYWAGPLIGGGLAGIVYDLFFI 240
297823489 160 YATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFI 239
297818190 161 YATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAIVSWTWTNHWVYWAGPLVGGGLAGIIYDFVFI 240
15231569  241 DENAHEQLPTTDY 253
15228041  240 -NTTHEQLPTTDY 251
242036929 239 -SQTHEQLPTTDY 250
225441155 240 -SHTHEQLPSTDY 251
225436454 240 -HHTHEPLPGSEF 251
224118422 244 SHSTHEPLPGGEF 256
255556846 240 -HSTHEQLPTTDY 251
255565467 241 -TYSHEPVPSSEL 252
297823489 240 -NTTHEQLPTTDY 251
297818190 241 DENAHEQLPTTDY 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap