Conserved Protein Domain Family
PLN00026

?
PLN00026: PLN00026 
aquaporin NIP; Provisional
Statistics
?
PSSM-Id: 177663
View PSSM: PLN00026
Aligned: 13 rows
Threshold Bit Score: 488.988
Threshold Setting Gi: 242033971
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224075688   1 MDNAEVPSVPSTPA-TPGTPGAPLFGGFKGERGV-----HGRKSLLRSCKCFSVEe-wAMEEGRLPPVSCSLPPPPVSLA 73 
15235034    7 EVGAVMVMAPPTPG-TPGTPGGPLITGMRVDSMS-----FDHRKPTPRCKCLPVM---GSTWGQHDTCFTDFPSPDVSLT 77 
15220826    1 MDHEEIPSTPSTPAtTPGTPGAPLFGGFEGKRNGhn-grYTPKSLLKSCKCFSVDnewALEDGRLPPVTCSLPPPNVSLY 79 
224117684   3 GPEEAGTPTVTAPN-TPGTPGGPLFTGLRVDSLS-----YSDRKIMPKCKCLPVT---APNWGQPHTCFLDIPSPDVSLT 73 
224056721   2 PESEAGTPAVSAPN-TPGTPGGPLFTGLRVDSLS-----YSDRKIMPKCKCLPVT---APTWGQPHTCFLDFPAPDVSLT 72 
224053394   1 MDNEEVPSAPSTPA-TPGTPGAPLFGGFKGERGV-----HGKKSLLRSCKCFGVEe-wAMEEGRLPPVSCSLPPPPVSLA 73 
225426464   2 AEAETGTPTASAPA-TPGTPGGPLFSSLRVDSLS-----Y-DRKSMPRCKCLPVG---AASWAPSPTCFTDFPAPDVSLT 71 
242033971   3 EPGSTTPPNGSAPA-TPGTPAPLFSGGPRVDSLS-----Y-ERKSMPRCKCLPAVegwGIA---THTCVVEIPAPDVSLT 72 
255555875   2 PESEAGTPTVSAPN-TPGTPGGPLFSALRIDSLS-----Y-DRKSMPRCKCFPVN---APTFGPPHTCFTDFPAPDISLT 71 
255572751   1 MDNEEVPSAPSTPA-TPGTPGAPLFGGFKGDRGNgngvgFGRKSLLKSCKCFSVEe-wSLEEGRLPPVSCSLLPPPVSLA 78 
297813479   7 EVGSVVVMAPPTPG-TPGTPGGPLITGMRVDSMS-----FDHRKPTPRCKCLPVM---GSTWGQHDTCFTDFPSPDVSLT 77 
297839859   1 MDHEEIPSMPSTPAtTPGTPGAPLFGGFEGKRNGhn-gkYTPKSLLKSCKCFSVDnewALEDGRLPPVSCSLPPPNVSLY 79 
297610778     --------------------------------------------------------------------------------    
224075688  74 RKVGAEFIGTLILIFAGTATAIVNQKTQGSETLVGLAASSGLAVMIVILATGHISGAHLNPSITIAFAALKHFPWKHVPV 153
15235034   78 RKLGAEFVGTFILIFTATAGPIVNQKYDGAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPA 157
15220826   80 RKLGAEFVGTLILIFAGTATAIVNQKTDGAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPV 159
224117684  74 RKLGAEFVGTFILIFMATAGPIVNQKYDHAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPA 153
224056721  73 RKLGAEFVGTFILIFAATAGPIVNQKYNNAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPA 152
224053394  74 RKLGAEFMGTLILIFAGTATAIVNQKTQGSETLIGLAASTGLAAMIVILSTGHISGAHLNPSITIAFAALKHFPWKHVPV 153
225426464  72 RKLGAEFVGTFILIFAATAGPIVNQKYSGVETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPA 151
242033971  73 RKLGAEFVGTFILIFFATAAPIVNQKYGGAISPFGNAACAGLAVTIIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPA 152
255555875  72 RKLGAEFVGTFILIFAATAGPIVNQKYNGVETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPA 151
255572751  79 RKVGAEFIGTLILMFAGTATAIVNQKTQGTETLIGLAVSTGLAVMIVILSTGHISGAHLNPSITIAFAALRHFPWKHVPV 158
297813479  78 RKLGAEFVGTFILIFTATAGPIVNQKYDGAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPA 157
297839859  80 RKLGAEFVGTLILIFAGTATAIVNQKTDGAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPV 159
297610778   1 -----------------------------------------------------------------------------VPA 3  
224075688 154 YIGAQVLASLCAAFALKGIFHPVMGGGVTVP--SGGYGQAFALEFITSFILMFVVTAVATDTRAVGELAGIAVGATVMLN 231
15235034  158 YIAAQVSASICASFALKGVFHPFMSGGVTIP--SVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLN 235
15220826  160 YIGAQVMASVSAAFALKAVFEPTMSGGVTVP--TVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAGIAVGATVMLN 237
224117684 154 YIAAQVSASICASFALKGVFHPFMSGGVTVP--SVSTGQAFALEFFITFNLLFVVTAVATDTRAVGELAGIAVGATVMLN 231
224056721 153 YIAAQVSASICASFALKGVFHPFMSGGVTVP--SVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLN 230
224053394 154 YIGAQVLASLCAAFALKVIFHPMMGGGVTVP--SGGHGQAFALEFIISFILMFVVTAVATDTRAVGELAGIAVGATVMLN 231
225426464 152 YIAAQVSASICASFALKAVFHPFMSGGVTVP--SVSIGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLN 229
242033971 153 YVSVQVLGSICASFALKGVFHPFLSGGVTVPdvTISTAQAFFTEFIISFNLLFVVTAVATDTRAVGELAGIAVGAAVTLN 232
255555875 152 YIAAQVSASICASFALKGVFHPFMSGGVTVP--SVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLN 229
255572751 159 YIGAQVSASVCAAFALKVIFHPFMSGGVTVP--SGGYGQAFALEFIISFNLMFVVTAVATDTRAVGELAGIAVGATVTLN 236
297813479 158 YIAAQVSASICASFALKGVFHPFMSGGVTVP--SVGVGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLN 235
297839859 160 YIGAQVMASVCAAFALKAVFEPTMSGGVTVP--TVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAGIAVGATVMLN 237
297610778   4 YVAVQVLGSICAGFALKGVFHPFLSGGVTVPdpTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGELAGIAVGAAVTLN 83 
224075688 232 IFIAGETTGASMNPVRTLGPAIAVNNYKAIWIYLTAPILGALCGAGTYSAVKLPEEDGDSNEKtsaARSFRR 303
15235034  236 ILVAGPSTGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLGAISGAAVYTGVKLNDSVTDPPRP---VRSFRR 304
15220826  238 ILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTIVKLPEEDEAPKER----RSFRR 305
224117684 232 ILVAGPSTGGSMNPVRTLGPAIAAGNYKKIWIYLVAPTLGAVVGAGAYTLVKLRDDETDPPRP---VRSFRR 300
224056721 231 ILVAGPSSGGSMNPVRSLGPAVAAGTYKDIWIYLVAPTLGALVGAATYTAVKLREEEADPPRQ---VRSFRR 299
224053394 232 ILIAGETTGASMNPVRTLGPAIAANNYKAIWVYLTAPILGALCGAGTYSAVKLPEEDGDTNEKtsaTRSFRR 303
225426464 230 ILVAGPSSGGSMNPVRTLGPAVAAGNYRAIWIYLVAPTLGAVAGAAIYTAVKLRADEGEQPRQ---VRSFRR 298
242033971 233 ILVAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLGALAGAGVYTAVKLRDENGETPRT---QRSFRR 301
255555875 230 ILVAGPSSGGSMNPVRTLGPAVAAGNYRALWIYLVAPTLGAIAGAGTYSAVKLREEEVDPPRP---VRSFRR 298
255572751 237 ILIAGETTGASMNPVRTLGPAIAANNYKAIWVYLTAPILGALCGAGIYSAVKLPEEDGDAREKpstARSFRR 308
297813479 236 ILVAGPSTGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLGAIAGAAVYTGVKLNDSVTDPPRQ---VRSFRR 304
297839859 238 ILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTIVKLPEENEAPKER----RSFRR 305
297610778  84 ILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAGVYTAVKLRDENGETPRP---QRSFRR 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap