Conserved Protein Domain Family
PLN00023

?
PLN00023: PLN00023 
GTP-binding protein; Provisional
Statistics
?
PSSM-Id: 177661
View PSSM: PLN00023
Aligned: 15 rows
Threshold Bit Score: 451.626
Threshold Setting Gi: 302757293
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18424871    2 KFWRERER-----ENKEQI-LAPLCGQVRVLVVGDSGVGKTSLVHLINKGSSIVRPPQTIGCTVGVKHITYGSPASSS-- 73 
115451843   1 MFWKDSGGrssggGGGLEQnGVGPFGQVRVLVVGDSGVGKSSLVHLILKGSAIARPAQTVGCAVGVKHITYGSAGGSS-- 78 
115481048   2 RFWRDSGGgg-sgGGRDLNgGGTPCGQVRVLVVGDSGVGKSSLVHLILKGSAIARPPQTIGCAVDVKHITYGSPGSSSns 80 
224083815   1 MFWRDRER-----ENKDQN-GGPPCGQVRVLIVGDSGVGKTSLVHLIIKSSSIARPPQTIGCTVGVKHITYGNSGSSS-- 72 
225463111   1 MFWRERER-----ESEERSgGGPPFGQVRVLVVGDSGVGKTSLVHLIIKGSSISRPPQTIGCMVGIKHLTYGSSSSSS-- 73 
225438537   1 MFWRERDR-----ENKEHNgGGPPCGQVRVLVVGDSGVGKTSLVHLLVKGSSITQPPQTVGCTVGVKHTAYGNSGSSS-- 73 
242041587   1 MFWKDSGSrsssgSGRDQN-GVGPFGQVRVLIVGDSGVGKSSLLHLILKSSAIARPAQTVGCTVGVKHVTYGSAGGSS-- 77 
242034765   2 MFWKDGGGtg-ggNGRDLS-GGPPCGQVRVLVVGDSGVGKSSLVHLLLKGSAVARPAQTIGCAVGVKHITYSSPGSSS-- 77 
255585889   1 MFWRDRER-----ENKDQN-GGPPCGQVRVLVAGDSGVGKTSLVHLIVKGSSTAHPPQTIGCTVGVKHVTYGNSGSSS-- 72 
302775196   1 MYRRAKEE------------ALPPTGQVRVLIVGDAGVGKSSLAQLIVDGSCGKDVARTIGCTVHVKHIQHTTLANSF-- 66 
18424871   74 -SSIQGDSERDFFVELWDVSGHERYKDCRSLFYSQINGVIFVHDLSQRRTKTSLQKWASEVAATGTFSAPLPSGGPGGLP 152
115451843  79 -NNIISDVQRNFFVELWDVSGHERYRTCRSIFYTQINGVIFVYDLSQRKTKTNLNKWAVEVAETGTFSAPLGSGGPGGLP 157
115481048  81 iNSIKGDAERNFFVELWDVSGHERYKECRSLFYSQINGVIFVYDLSQRKTKTNLNKWAVEVAESGTFSAPLGSGGPGGLP 160
224083815  73 -SSIKGDSERDFFIELWDVSGHERYKDCRSLFYSQINGVIFVHDLSQRRTKTSLQKWASEIAATGTFSAPLSSGGPGGLP 151
225463111  74 -NSNKGNTERDFFVELWDVSGHERYKDCRSLFYSQINGIIFVHDLSQKRTKTSLQKWASEIAGNGTFSAPLGSAGPCGLP 152
225438537  74 -NSIKGDSERDFFIELWDVSGHDRYKECRSLFYSQINGVIFVHDLSQRRTKASLQKWAAEIAATGTFSAPLGSGGPCGLP 152
242041587  78 -NNIS-DAERNFFVELLDVSGHERYKACRSIFYTQINGVIFVYDLSQRKTKTNLNKWAVEVAETGTFSAPLGSGGPGGLP 155
242034765  78 -NSIKGDAERNFFVELWDVSGHERYKDCRSLFYSQINGVIFVYDLSQRKTKTNLNKWAVEVAESGTFSAPLGSGGPGGLP 156
255585889  73 -SSLKGDAERDFFVELWDVSGHERYKDCRSLFYSQINGVIFVHDLSQRRTKTSLQKWASEIAATGTFSAPLGSGGPCGIP 151
302775196  67 ---------QDFFVELWDVSGNEWYKDCRSLFYSQINGIIFVHDLSQRKTKSSLQKWAREVASLGHFSAPLPSSGMGLVP 137
18424871  153 VPYIVVGNKADIAAKEGTKGSSGNLVDAARHWVEKQGLLPsSSEDLPLFESFPGNGGLIAAAKETRYDKEALNKFFRMLI 232
115451843 158 VPYLVIANKVDLVPRDGSRVSSGSLVDFARQWVEKQGLLP-SSEELPLTDSFPGNSGLLSAAKEARYDKEAVIKFFRMLI 236
115481048 161 VPYLVIANKVDIAPRDGKRVSSGNLVDVARQWVEKQGLLP-SSEELPLAESFPGNSGLLTAAKVARYDKEALVKFFRMLI 239
224083815 152 VPYIVVSNKADVAAKEGTRGSSGNLVDAARHWVEKQGLLP-SSEEIPLTESFPGSGGLISAAKEARYDKEAVVRFFRMLI 230
225463111 153 VPFIVIGNKVDIATKEGQRGSSGNLVDVARQWVEKQGLLP-SSEELPLTESFPGSGGLIAAAKEARFDKEAVKKFFLMLI 231
225438537 153 VPFIVIGNKTDIAAKEGTRGSSGNLVDVARQWVEKQGLLP-SSEELPLTESFPSSGGILAAAKEARVDKEAVMKFFRLLI 231
242041587 156 VPYLVIANKVDIVPRDGTRASRGNLVDLARQWAEKQGLLR-CSEELPLTESFPGNSGLVSAAKQARYDKEAVIKFFRLLI 234
242034765 157 VPYLVIANKVDIAPRDGRRVSSGNLVDVARQWVEKQGLLP-SSEELPLADSFPGNSGLLTAAKEGRYDKEALIKFFRMLI 235
255585889 152 VPYIVIGNKADVAAKEGTRGSSGNLVDVARQWVEKQGLLP-SSEELPLTESFPGGGGLIAAAKEARYDKEALLKFFRMLI 230
302775196 138 VPFLVIGNKADIAPKAG--GSSGNLVDAARHWVEKQGLLS-PTDELPTSETFPGTQGLRAAAKDGELDMEAIDDFFSMLI 214
18424871  233 RRRYFSDELPAASPWSISPvpTSSSQRLDEITSDDDQFYKRTSfhGDPYKYnNTIPPLPAQRNLTPPPTLYPQQPV-STP 311
115451843 237 RRRFFSNEPAAPSPWSLTP--REDSILPVETLKDEVDSFQRKS--GEDFMY-KGVNPLPAQRNLASPPDLSPQQPV-FSL 310
115481048 240 RRRYFSNELPAPSPWSLTP---REDTILPVETTNDDDLFQRKSyaGQSYKY-SGVTPLPAQRNLTPPPTLYPQQPMsSSS 315
224083815 231 RRRYFSDELPASSPWSASPv-QRSVQRLDENISDEDPFYKATSlaGDSYKY-NMLPPLPAQRNLTPPPTLYPQQPV-SVR 307
225463111 232 RRRYFSNELPAPNPWSSSPf-EGPAPHSSNNLSDDDVFHMNTSlsGDPYKY-NILPPLPA-RNYMPPSAQRPQQPV-SIS 307
225438537 232 RRRYFSDELPAPSPWSISPv-QGPIQRAGDNLSEDNQFYKNTSlgGDPYKY-NVLPPLPAQRNLTPPPTLYPQQPV-SVA 308
242041587 235 RRRYFSNEPPAPSPWSLTP--REDTILPVESLGGGVDSFQRKSlsGDGFLY-NGVVPLPAQRNLTPPPTLNPQQPV-SSL 310
242034765 236 RRRYFSNELPAPSPWSLTP---REDTILPVESVNDDDMFQRKSygGQSYKY-NGVAPLPAQRNLTPPPTLYPQQPMsSSS 311
255585889 231 RRRYFSDELTAPSPWTVSPa-QRSVQRLDENSSDDDQFYKSKRltGDPYKY-NMLPPLPAQRNLTPPPTLYPQQPV-SVT 307
302775196 215 RRRYFGEGISTYFS--------------------------------------STQSNIPVNSTNQMPSSSFMYNGL---- 252
18424871  312 DNYTIPRYSLSSVQETTNngsARSKRMD-INV 342
115451843 311 DNYRYHRYSSPSLPDVSS---SRTSRED-IDV 338
115481048 316 ENYRYHRFSSSAIPDASS---SRTNRAD-INI 343
224083815 308 ESYGIPRFPLSGSQEISNt--ARSKRMD-INV 336
225463111 308 DNYNLPRFTRTESPNSSN---SRSKRAD-INI 335
225438537 309 ENYNLPRFALNGSPEIIN---TRQKRAD-INV 336
242041587 311 DNYRYHRFSSSSLPDVSS---NRTSREDiIDV 339
242034765 312 ENYRYHRFSSSSIPDSSG---GRTSRAN-LNI 339
255585889 308 ENYSFPRFSLSDAQELSNt--ARSKRLD-INV 336
302775196 253 ---------------------ARSNSSSrYRL 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap