Conserved Protein Domain Family
PLN00021

?
PLN00021: PLN00021 
chlorophyllase
Statistics
?
PSSM-Id: 177659
View PSSM: PLN00021
Aligned: 26 rows
Threshold Bit Score: 390.949
Threshold Setting Gi: 302786110
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225467857   1 MAALEARPAPAAATDAFKRGKYTAKPITTCN------------------------APKTLFIVTPDT---EGTYPVLLFL 53 
115482054  21 LQLQTTMAGDSSFSGVFDHGSHGVTLVKVDEaprkcssaaaakktdddtapaggaPPKPLLVAAPCD---AGVYPVVVFL 97 
168001721   1 ----MEDPIPNVHGGIYEDGPFKIEIVHVDDasssstclkk----sraavdrenlSPKPLVVALPKE---EGVYPVIQFH 69 
242039645  16 LLHRCMGMGSENAGGVFDQGGHGVSLTRLDEasrapsrcavr---pphpsgaaslPPKPLLVAAPRE---AGEYPVLLFL 89 
255559831  12 YFSRAKNQAVPKAPSVFETGYFPTELNNVNEsefa-----------------sgsPPKPLLIARPTV---AGKYPAILFI 71 
302765915   1 -------------------------MFTINQr-----------------------RLLPLRVFTPSS---NGTFPLIVFH 29 
302765911   1 ----------------------------------------------------------PLRVFTPSS---NGTFPLIVFH 19 
302760641   1 -------------------------------------------------------PPKPLLVAAPSNpapADGFPVLILF 25 
302792849  20 VCSEELIRQHVYDGSIYDTGSFNVSVFTINQr-----------------------RLLPLRVFTPSS---NGTFPLIVFH 73 
302786110   1 -------------------------------------------------------PPKPLLVAAPSNpapADGFPVLILF 25 
225467857  54 HGYNICPCCYTNLLEHISSHGYIVVAPRLLS--------LCSLYGRPDINSAAEVANWLSS-GLQPVLPE---NVVPDLS 121
115482054  98 HGYLAYNSFYSQLFEHVASHGFVVVGPQLYT--------MSGPDTTDEINSAAAVINWLAAgGLTSKLPP---NVRADAT 166
168001721  70 HGFTLQNMFYSQIISHIASYGFIVVAPQMYK--------ISGSDATTEIEDAVQILNWMPT-GLVAALPEtlsKHRPDFS 140
242039645  90 HGYLAVNSFYSQLFQHVASHGFIVVGPQLYT--------ISGPDTTEEINAAAAVIDWLAT-GLPSTLPP---GVRADLT 157
255559831  72 HGTCLVNSFYGDLLDHVASHGFIVVAPQIYTctvfgaipVMPIDGQKEVDLSTEVANWLPS-GLKSVLNG---GVQANLD 147
302765915  30 HGTFLKTRIYTGILTHIASYGYVVVAPQRSDs-------FWDTNATRDIEDAARVIEWLLG-NFAAFLPA---GVSVNVG 98 
302765911  20 HGAFLETRIYTDILTHISSHGYVIVAPQRSDr-------FWDTNATRDIKDAARVIEWLVG-NFAAFLPA---GVSVNIG 88 
302760641  26 HGFCLSNLFYRQLMRHIASHGFIVVAPQMYR--------FAGPDASPEIEDAAAIISWIPG-NLHRFLPAd--GVRADAT 94 
302792849  74 HGAFLETRIYTDILTHIASHGYVIVAPQRSDr-------FWDTNATRDIKDAARVIEWLLG-NFAAFLPA---GVSVNIG 142
302786110  26 HGFCLSNLFYRQLMRHIASHGFIVVAPQMYR--------FAGPDASPEIEDAAAIISWVPG-NLHRFLPAd--GVRADAT 94 
225467857 122 RLALAGHSRGGYLAFALALGNANVSMN-----LKFLTLIGIDPVAGANKCMKMCPKILT-GVPHSFNLDIPVMVIGTGLG 195
115482054 167 KISISGHSRGGKVAFALALGHANVSLRggaggATIAALVAVDPVDGFAAGKQTPPPILTyGGANSLRVPAPVMVIGTGLG 246
168001721 141 KVALVGHSRGAKVVFGLALGVRNSI-------LQYSAVVGLDPVDGMGIGQQTNPPILQ-FSEGSLNLGVPTLIIGTGLG 212
242039645 158 KVSVSGHSRGGKVAFALALGRAKAKLA-----LPLVALVAVDPVDGMGVGKQTPPPVLT-GRTTSLHVGVPAMVIGTGLG 231
255559831 148 KLAISGHSRGGKTAFAIQFGYSTDALT-----TKFSALVGLDPVAGHSKESRTDPKVLT-YAPHSFNLSIPVSVIGTGLG 221
302765915  99 KLVNMGHSKGGKIAFALALNIKANIS------VPFATLVGLDPMDGTKLG-QTQPRVLY-DAPIVFQ--YPSLIIGTGLS 168
302765911  89 KLVNMGHSKGGKIAFALALNIKANVS------VPFATLVGLDPMDGTKIG-QTQPRVLY-DAPIVFQ--YPSLIIGTGLG 158
302760641  95 KLAIAGHSRGGKVAFSLALGFSKRSLP-----SRVSALIALDPVDGTSSASQTNPPVLR-YRKDSLQPNCPVLIIAAGYG 168
302792849 143 KLVNIGHSKGGKIAFALALNIKANVS------VPFATLVGLDPMDGTRLG-QTQPRVLY-NAPIVFQ--YPSLIIGTGLG 212
302786110  95 KLAIAGHSRGGKVAFSLALGFSKRSLP-----SRVSALIALDPVDGTSSASQTNPPVLR-YRKDSLQPNCPVLIIAAGYG 168
225467857 196 GESViGCIPcSCAPDGLNYAEFFNE--CKDNCLGFVIPDYGHMDMLDDDyctncIGTSIGAIMGSMCKSGKgDKTSMMEC 273
115482054 247 GLARaAPLLpACAPPGVSHGEFYGE--CAAPACHLVARDYGHTDMMDDV-----TPGARGLATRAVCRSGG-ARAPMRRF 318
168001721 213 PLRKnFLFP-ACAPAGVSHEAFYYD--SAAPAFHFVASKQGHMDFLNDD-----CSGPTGMFSYCLCKNGP-TRKPMRRF 283
242039645 232 ELPRgPLLP-PCAPRGVSHAAFFDEldRAAPACHLVARDYGHTDMMDDD-----TPGARGMLTRTVCRSGG-ARAPMRRF 304
255559831 222 SQPQtLF---ACAPDGVNHAEFYNE--CRPPANHFVATDYGHMDMLNDD------------------------------- 265
302765915 169 G---------ACSPARYNHGGFFNQ--TRSMVVDLIPSEYGHMDFVDDL-----GTFDGQRVFLLACKRKS-PRKPMRDF 231
302765911 159 G---------ACSPAKYNHASFFNQ--TSSMVVDLIPAKYGHMDFVDDL-----GAFDGQRVFLLACKRKS-PRKPMRDF 221
302760641 169 GEKKnFLFP-ACAPRGVGPQAFFRD--CCAPAFLLSAPEHGHFDFLDDA-----TSGLKGGLTSLVGKNGK-ARKPMRIF 239
302792849 213 G---------ACSPAKYNHASFFNQ--TRSMVVDLIPAKYGHMDFVDDL-----GAVDGQRVFLLACKRKS-PRKPMRDF 275
302786110 169 GEKKnFLFP-ACAPRGVGPLAFFRD--CCAPAFLLSAPEHGHFDFLDDA-----TSGLKGGLTSLVGKNGK-ARKPMRIF 239
225467857 274 VGGIVVAMLMAHLEGETGDLDAIVDEPGIAPVKLDGRGGLRT 315
115482054 319 FGGAMVAFVKRWVEGEPELLDCVRARPETAPVVLSAVEFRDE 360
168001721 284 SGGMVVAFLRAAFFGETAPLVAALATPELAPIPLDRPEFKGK 325
242039645 305 VAGATVAFLNKWVAGDAAAMDGIRTRPDQAPVALSVVEFRDE 346
255559831 266 ---LXXRFVPSNP----------------------------- 275
302765915 232 TAGAVVAFLRAVLYNVTDAFVNIVRNPSSAPVLLQEPLVHIA 273
302765911 222 TAGAVVAFLRAALYDDTDAFANIVKNPSSAPVLLQKPLVHN- 262
302760641 240 TAGAIVAFLQA------------------------------- 250
302792849 276 TAGAVVAFLRAALYDDTDAFANIVKNPSSAPVLLQKPLVHN- 316
302786110 240 TAGAIVAFLQA------------------------------- 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap