Conserved Protein Domain Family
PLN00017

?
PLN00017: PLN00017 
photosystem I reaction centre subunit VI; Provisional
Statistics
?
PSSM-Id: 177656
View PSSM: PLN00017
Aligned: 19 rows
Threshold Bit Score: 134.125
Threshold Setting Gi: 302757878
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145354327   1 AMKTNAKYGDESVYFDLSDVEATTGSWDVYGVDASSRYPDQQAAFFEYAAQGLGRREAVYSLLAVSAGLLTVGYGVKGAK 80 
145354259  29 AMKTNAKYGDESVYFDLSDVEATTGSWDVYGVDASSRYPDQQAAFFEYAAQGLGRREAVYSLLAVSAGLLTVGYGVKGAK 108
159464799  25 AVRVSAKYGENSRYFDLQDMENTTGSWDMYGVDEKKRYPDNQAKFFTQATDIISRRESLRALVALSGIAAIVTYGLKGAK 104
168028893  40 VGVVSAKYGEKSVYFDLGEIDNTTGNWDLYGNDDPNRYNGFQNKFFETFAGAFTKRGLLLKFLVLGGATTIGYLGSTSSP 119
168047946  40 VGAISAKYGEKSVYFDLGEIDNTTGNWDLYGNDDPNRYNGFQNKFFETFAGAFTKRGLLLKFLVLGGATTIGYLGSTSSG 119
224073967  44 SGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASG 123
255549948  44 NGAVEAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYLSATATG 123
255075737  30 AVQTNAKYGDESVYFDLGDVESTTGSWDVYGVESKARYPDQQEKFFEQAAQGLGRREAMYSFLALAGPAACLVFGAKGSK 109
302758982  40 KLGVSAKYGEKSVYFDLGDINNTTGAWDLYGSDMPSPYNGLQSQFFQIFAGAFTKRGLLLKFLLLAGTGAVAFTGANAPA 119
302757878  40 KLGVSAKYGEKSVYFDLGDINNTTGAWDLYGSDTPSPYNGLQSQFFQIFAGAFTKRGLLLKFLLLAGTGAVAFTGANAPA 119
145354327  81 DAkLPITVGPQ 91 
145354259 109 DAkLPITVGPQ 119
159464799 105 DAdLPITKGPQ 115
168028893 120 DL-LAIKNGPK 129
168047946 120 DL-LAIKNGPK 129
224073967 124 DI-LPIKKGPQ 133
255549948 124 DV-LPIKKGPQ 133
255075737 110 DAkLPITVGPQ 120
302758982 120 SL-VPVKRGAV 129
302757878 120 SL-VPVKRGAV 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap