Conserved Protein Domain Family
PLN00015

?
PLN00015: PLN00015 
protochlorophyllide reductase
Statistics
?
PSSM-Id: 177654
View PSSM: PLN00015
Aligned: 30 rows
Threshold Bit Score: 499.232
Threshold Setting Gi: 145348929
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145348929   1 IVTGSSSGLGLYTAKALIKNG-YFVVNAVRSPEKMQVKANELGLDESSYAIMYLELGDLQSVRDFATEFRrsKYVKNFQA 79 
115482724   1 --------------------------MGCRDFLKASRAAKAAGMEKGSYTIVHLDLASLDSVRQFVANVR--RLEMPVDV 52 
159462468  89 IITGASSGLGLNAAKALAATGeWHVVMACRDFLKAEQAAKKVGMPAGSYSILHLDLSSLESVRQFVQNFK--ASGRRLDA 166
168032976  92 IITGASSGLGLATAKVLADSGeWHVIMACRDFLKAERAARAVGMPKDSYTVIHCDLSSLNSVKQFVDNVR--QSGRPLDV 169
168039300  92 IITGASSGLGLATAKVLADSGeWHVIMACRDFLKAERAAKSVGMPKENYTVMHCDLSSLNSVKQFVDNFR--RSGRPLDV 169
219117802  92 VITGASSGLGLNCATTLAKTGrYFVVMACRDVEKGKQVAKEKGLPDNSYVVMKLELGNLQSVRDFVSNLKafKAARPLTH 171
224001730  93 VITGASSGLGLNCAATLAKTGrHFVVMACRDVEKGKRVAKEFGMPDDSYVVMKLELGSLQSVRDFVFNLKafKSARPVNN 172
242074784  75 VITGASSGLGLAAAKALAETGkWHVVMACRDFLKTAKAAKGAGMADGSYTIMHLDLASLDSVRQFVDNFR--RAGMPLDS 152
242039231  85 VITGASSGLGLATAKALAETGkWHVIMACRDFLKASRAAKAAGMDKDSFTIVHLDLASLDSVRQFVKNVR--QLEMPIDV 162
302837438  89 IITGASSGLGLNAAKALAATGeWHVVMACRDFLKAEKAAKAIGMPAGSYSVLHLDLSSLESVRQFVANFK--ATGRRLDA 166
145348929  80 LVCNAALYLPNATVPSYTKDGFEECVGVNHLGHHLLSLLLLDDLAeAPDANMKRLIIVGSVTGNTNTLAGQ-VPPRAGLG 158
115482724  53 VVCNAAVYQPTAKQPSFTADGFEMSVGVNHLGHFLLARELLADLT-SSDYPSKRLIIVGSITGNTNTLAGN-VPPKANLG 130
159462468 167 LVCNAAVYLPTAKEPRFTADGFELSVGTNHLGHFLLTNLLLDDLK-NAPNKQPRCIIVGSITGNTNTLAGN-VPPKANLG 244
168032976 170 LVCNAAVYLPTAKEPRYTADGFELSVGTNHLGHFLLANMLMEDIQhKENDTNRRVIIVGSITGNTNTIAGN-VPPKANLG 248
168039300 170 LVCNAAVYLPTAKEPRYTADGFELSVGTNHLGHFLLANLLMEDIQhKENNNSRRVIIVGSITGNTNTVAGN-VPPKANLG 248
219117802 172 LICNAAVYKPKDPEPAWTDDGFEMSMGVNHLGHFLLVHLLMDDMS-RAK--GARVCIVGSITGNTNTVGGGlVYPQADLG 248
224001730 173 LICNAAVYKPTDPEPAWTDDGFEQSMGINHFGHFLLVNLMVDDLA-KAK--GARCCIVGSITGNSNTV-GL-VYPRADLG 247
242074784 153 LVCNAAIYRPTARTPTFTADGYEMSVGVNHLGHFLLARLLLDDLQ-RSDYPSRRLIILGSITGNTNTLAGN-IPPKAGLG 230
242039231 163 VVCNAAVYQPTAKDPSYTADGFEMSVGVNHLGHFLLARELLSDLQ-SSDYPSKRLIIVGSITGNTNTLAGN-VPPKANLG 240
302837438 167 LVCNAAVYLPTAKEPRFTADGFELSVGTNHLGHFLLSNLLLEDLK-NAPNKQPRCIIVGSITGNTNTLAGN-VPPKANLG 244
145348929 159 DMSGLRNGFknSDRNQGaLIDGTR-FIGAKAYKDSKLCNMLDIKAFAERFGESTGIKFSTMYPGCIADSNLFRNHTAFFR 237
115482724 131 DLRGLASGL--DGVSSSaMIDGGE-FDGAKAYKDSKVCNMLTMQEFHRRYHGETGVTFASLYPGCIATTGLFREHVPLFR 207
159462468 245 DLSGLAAGV----PAANpMMDGQE-FNGAKAYKDSKVACMMTVRQMHQRFHDATGITFASLYPGCIAETGLFREHVPLFK 319
168032976 249 DLRGLAGGL--DGVRSSvMIDGGE-FDGAKAYKDSKVCNMLTMQEMHRRFHEKTGVTFASLYPGCIATTGLFREHYQLFR 325
168039300 249 DLRGLAGGL--DGVRSSvMIDGGE-FDGAKAYKDSKVCNMLTMQEMHRRFHEKTGVTFASLYPGCIATTGLFREHYSLFR 325
219117802 249 KLQGFEKGA----KKPVaMADGKP-FFGAKAYKDSKVCNMMTVSELNRLYHKDTGIVFSSMYPGCIAETALFREKRPWFR 323
224001730 248 NLQGFAQGA----KEPIaMADGKP-FFGAKAYKDSKVCNMMTVSELHRRYHDSTGIAFSSMYPGCIAETQLFREKRPWFQ 322
242074784 231 DLRGLAGGL--RGQNGSaMIDGSEsFDGAKAYKDSKICNMLTMQELHRRYHEDTGITFASLYPGCIATTGLFREHIPLFR 308
242039231 241 DLRGLAGGL--NGIGSSvMIDGGE-FDGAKAYKDSKVCNMLTMQEFHRRYHEETGVTFASLYPGCIATTGLFREHIPLFR 317
302837438 245 DLSGLAGGV----SPANpMMDGQE-FNGAKAYKDSKVACMMTVRQMHQRFHESTGVTFASLYPGCIAETGLFREHYGIFK 319
145348929 238 WFFPILQKNVTKGYVSEEEAGERLASIVYDPRYSEQGAYWAWKGGGDQlwdnynnn----nddtrtiaFNNKPSKEGRDM 313
115482724 208 LLFPPFQKYITKGYVSEEEAGKRLAQVVSDPSLTKSGVYWSWNNNSAS--------------------FENQLSEEASDP 267
159462468 320 TLFPPFQKYITKGYVSEEEAGRRLAAVISDPKLNKSGAYWSWSSTTGS--------------------FDNQVSEEVADD 379
168032976 326 TLFPPFQKYITKGYVSEEEAGKRLAQVVSDPTLNKSGVYWSWNNQSNS--------------------FENELSQEASDA 385
168039300 326 TLFPPFQKYITKGYVSEEESGRRLAQVVSDPSMNKSGVYWSWNNQSGS--------------------FENELSQEASDA 385
219117802 324 KAFPWFMKYVTGGYVGMEEAGERLAQVIDDPQCTKSGVYWSWNGGAQTvgrwspdgkprgaggsggeiFENQQSDAVRDL 403
224001730 323 KAFPWFMKYVTGGYVGMEEAGERLAQVVDDPQCTKSDVYWSWNGGAQQvgrwsddgkpkgaggsggeiFENEQSDAVRDR 402
242074784 309 LLFPPFQKFITKGFVSEAESGKRLAQVVSDPSLTKSGVYWSWNKDSAS--------------------FENQLSQEASDP 368
242039231 318 LLFPPFQKYITKGYVSEEEAGKRLAQVVSDPSLTKSGVYWSWNKNSAS--------------------FENQLSEEASDS 377
302837438 320 TLFPPFQKYVTKGYVSEEEAGKRLAQVISDPKLNKSGAYWSWSSSKGS--------------------FENQVSEEVADD 379
145348929 314 AKANEVFDISTELVG 328
115482724 268 EKAKKVWELSEKLVG 282
159462468 380 SKASKLWDISAKLVG 394
168032976 386 EKAKKLWEISEKLVN 400
168039300 386 EKAKKLWEVSEKLVG 400
219117802 404 PTAKKMWKLSREAVG 418
224001730 403 ETAQKMWDYSVRAVG 417
242074784 369 EKARKLWEISEKLVG 383
242039231 378 DKAKKLWEISEKLVG 392
302837438 380 VKAVKLWELSAKLVG 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap