Conserved Protein Domain Family
PLN00014

?
PLN00014: PLN00014 
light-harvesting-like protein 3; Provisional
Statistics
?
PSSM-Id: 177653
View PSSM: PLN00014
Aligned: 23 rows
Threshold Bit Score: 289.838
Threshold Setting Gi: 145344198
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168061339  22 GGALSPNAGKSSQLLVSCRRWQGRYRTVVNVESTGSRFVVRASDGEGLGSAAdaggnsivlevaglpeepetegignlap 101
224155125   5 SISASLHRTCGSHRVTKKQRPQARTARSLGSKQATRAVTLNVEGQRGVGMSEq--------------------------- 57 
225454884   6 AITASLQRACSPHHVTKKQQPQARPARSMGTKQETHVVALETEGPKGLNIAEqeakf----------------------- 62 
225469105   1 -----MHLKEGLTLISRGRKPLTNYLQTIKGLANRSALANVSLRDDDLIIYAfnglgf---------------------a 54 
242060328   3 MATSTFSPRPATLNKPLRPGAKPASLLPFPCRRAGRLVCATAAGEAPPVEVEq--------------------------- 55 
224137948   1 MSLFPPPLTRLPLSFSSKHHIIFKPTLSLRPTSPPFLLSTSKASTDDGGAGV---------------------------- 52 
224134286     --------------------------------------------------------------------------------    
224126625   2 SISMSLFSPPLTRFPPSKPHFTYKSTLSLGPTNRPFLLSTPKASTDNGGAGV---------------------------- 53 
255566759   5 MALFSPPPTQFLRSLSSKPHLLTKPTSFLTPINPPFLFSAPKASTDNGA------------------------------- 53 
297804424   1 ---MALFSPPISSSSLQNPNFIPKFSFSLLSTNRFSLLSVTRASSDSGSTSPtsataveapepvev------iikeapqs 71 
168061339 102 ptsspRKPSPLAKGGTLDGP-----------------------QAEGKAPAAAT---------LGKTSPALSLGTFDDPR 149
224155125  58 ----qEKPALATGGSNKAND-----------------------KLENGLETKHS------------------VPKFIDER 92 
225454884  63 -gfnaGSSTTTSRDAKDDDE-----------------------AGSGLDTEPSA-------------------PKFSDER 99 
225469105  55 frepfSKREEIPTGSLLPGEiwcisfpfkfelfvaglamgvtnGSAMITLAPQGpirhtfialSIIMPLAIYICRLVKAR 134
242060328  56 -----RDEAEPAPAAASNGA-----------------------AVKAEAPAPKAv-------qAEAPPAPAPVPAFRDAR 100
224137948  53 -----SASSATVEEPKLEQK-----------------------APDSSESVPVAekns-ngavAPGGGVEVEVSKFEDPR 103
224134286     --------------------------------------------------------------------------------    
224126625  54 -----SASAATVEEPKLEQK-----------------------TPESSDSVPVAknss-ngavAAGGEEKVEVSKFGDPR 104
255566759  54 -----GISAAAAAVEEPKEA-----------------------EPKAAEPSPAAvesslgsngAVKDAEVKLESKFVDPR 105
297804424  72 tppvtKEEITTAKNVAVEGE-----------------------EMKTTET----------------------VIKFQDAR 106
168061339 150 WKNGTWDLSQFTTDGKTDWDAVIDAEVVRRKILETNPVSSNNEDEVVFDTSIVPWWAWVKRFHLPEAELLNGRAAMIGYA 229
224155125  93 WKKGTWDLNMFVRDGKMDWDGLIEAEAKRRKIIELYPNTCTNEEPVLFRSSIIPWWAWLKRSYLPEAELLNGRAAMVGFF 172
225454884 100 WKNGTWDLNMFVRDGKMDWDGVIVAEARRRKFLEMYPESATNQEPVLFRSSIIPWWAWMMRSHLQEAELINGRAAMVGFF 179
225469105 135 IKQHR-----------------LSSEVRRRKWLEDNPESSSNDDPVVFDTSIIPWWAWIKRFHLPEAELLNGRAAMIGFF 197
242060328 101 WVNGTWDLTQFDKGGVVDWDAVIDAEARRRKWLEDYPEATSTDEAVVFDTSIIPWWAWMKRFHLPEAEKLNGRAAMVGFF 180
224137948 104 WISGTWDLKQFEKDGKTDWDAVIDAEVRRRKWLEGNPESSSNDDPVVFDTSIIPWWAWMKRFHLPEAELLNGRAAMIGFF 183
224134286   1 ---------------------------MFPNHSPIYPNTCTNEEPVLFRSSIIPWWAWLKRSYLPEAELLNGRAAMVGFF 53 
224126625 105 WISGTWDLKQFQKDGKTDWDAVIDAEARRRKWLQCNPESSSNNDPVVFDTSIIPWWTWMKRFHLPEAELLNGRAAMIGFF 184
255566759 106 WIGGTWDLKQFQKDGSTDWDSVIDAEVRRRKWLESNPESSTNDDPVVFDTSIIPWWAWMKRFHLPEAELLNGRAAMVGFF 185
297804424 107 WINGTWDLKQFEKDGKTDWDSVIVAEAKRRKWLEENPETTSNDEPVLFDTSIIPWWAWIKRYHLPEAELLNGRAAMIGFF 186
168061339 230 SGWLVDAATGIGLVDQQNSFFGKLLLFISVVGVLAIRKTSDVDTIRDLAKESTYYDKQWQATWKDAKDPEKSDAL 304
224155125 173 AAYIVEGLTGLDMVGQTGNFICKTVLFVTVTGIILFRRTEDFKNLRKLVDEATFYDKQWQASWKDQNAPNTGASE 247
225454884 180 MAYLVDALTGLDVVGQTGNLICKAGLLVTVMGVIFFRRAQDFDSLRKLADEATLYDKQWQSSWQDQDAGDGDSGR 254
225469105 198 MAYLVDSLTGVGLVDQMGNFFCKTLLFVAVVGVLLIRKNEDLETLKKLVDETTFYDKQWQASWQDETPSSSKND- 271
242060328 181 MAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLLIRKNEDIESLKKLIDETTFYDKQWQATWQDDSTGGPKN-- 253
224137948 184 MAYLVDSLTGVGVVDQMGNFFCKTLLFVAVVGVLLIRKNEDLETIKTLLEETTFYDRQWQATWQDETSSIPKNE- 257
224134286  54 AAYIVEGLTGLDMVGQTGNFICKTVLFVTVTGIILFRRTEDFKNLRKLVDEATFYDKQWQASWKDQNAPNTGASE 128
224126625 185 MAYLVDSLTGVGLVDQMSNFFCKTLLFVAVVGVLLIRKNEDLETIKKLLEETTFYDKQWQATWQDEKSTSPKDD- 258
255566759 186 MAYFVDSLTGVGLVDQMGNFFCKTLLFIAVAGVLLIRKNEDIETLKKLVDETTFYDKQWQATWQDETPSSSKTE- 259
297804424 187 MAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDVDKLKNLFDETTLYDKQWQAAWKNDDDESLGSKK 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap