Conserved Protein Domain Family
PLN00011

?
PLN00011: PLN00011 
cysteine synthase
Statistics
?
PSSM-Id: 177651
View PSSM: PLN00011
Aligned: 12 rows
Threshold Bit Score: 587.74
Threshold Setting Gi: 42573493
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297813061   1 MEDRIsLIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAEDKGLITPGKSTLIEATGGN 80 
145334565   1 MEDRC-LIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAEDKGLITPGKSTLIEPTAGN 79 
42573493    1 MEDRV-LIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAEDKGLITPGKSTLIEATGGN 79 
79328865    1 MEDRC-LIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAEDKGLITPGKSTLIEPTAGN 79 
79328884    1 MEDRC-LIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAEDKGLITPGKSTLIEPTAGN 79 
15241111    1 MEDRC-LIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAEDKGLITPGKSTLIEPTAGN 79 
15241112    1 MEDRV-LIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAEDKGLITPGKSTLIEATGGN 79 
18397061    2 EEDRC-SIKDDATQLIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKERIAYGMIKDAEDKGLITPGKSTLIEATSGN 80 
30690901    1 MEDRC-LIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAEDKGLITPGKSTLIEPTAGN 79 
297829006   2 EEDRC-SIKDDATQLIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKERIAYGMIKDAEDKGLITPGKSTLIEATSGN 80 
297808839   1 MEDRC-SIKNDVTELIGNTPMVYLNNVVDGCVARIAAKLEMMEPFSSVKDRIAYSMIKDAEEKGLITPGKSTLIEPTAGN 79 
297795639   1 MEDRIsLIKNDVTELIGNTPMVYLNKIVDGCVAHIAAKLEMMEPCSSIKDRIAYSMIKDAEEKGLITPGKSTLIEATGGN 80 
297813061  81 TGIGLASIGASRGYKVILLMPATMSLERRIILRALGAEVHLTDMSIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIH 160
145334565  80 TGIGLACMGAARGYKVILVMPSTMSLERRIILRALGAELHLSDQRIGLKGMLEKTEAILSKTPGGYIPQQFENPANPEIH 159
42573493   80 TGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHLTDISIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIH 159
79328865   80 TGIGLACMGAARGYKVILVMPSTMSLERRIILRALGAELHLSDQRIGLKGMLEKTEAILSKTPGGYIPQQFENPANPEIH 159
79328884   80 TGIGLACMGAARGYKVILVMPSTMSLERRIILRALGAELHLSDQRIGLKGMLEKTEAILSKTPGGYIPQQFENPANPEIH 159
15241111   80 TGIGLACMGAARGYKVILVMPSTMSLERRIILRALGAELHLSDQRIGLKGMLEKTEAILSKTPGGYIPQQFENPANPEIH 159
15241112   80 TGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHLTDISIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIH 159
18397061   81 TGIGLAFIGAAKGYKVVLTMPSSMSLERKIILLALGAEVHLTDPSKGVQGIIDKAEEICSKNPDSIMLEQFKNPSNPQTH 160
30690901   80 TGIGLACMGAARGYKVILVMPSTMSLERRIILRALGAELHLSDQRIGLKGMLEKTEAILSKTPGGYIPQQFENPANPEIH 159
297829006  81 TGIGLAFIGAAKGYKVVLTMPSTMSLERKIILLALGAEVHLTDPSKGVQGIIDKAEEICSKTPDSIMLEQFKNPSNPETH 160
297808839  80 TGIGLACVGAARGYKVILVMPSTMSLERRIILKALGAELHLSEQRIGLKGMLEKTDAILSKTPGGYIPQQFENAANPEIH 159
297795639  81 TGIGLASIGASRGYKVILLMPATMSLERRIILRALGAEVHLTDMSIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIH 160
297813061 161 YRTTGPEIWRDSAGKVDILVAGVGTGGTVTGTGKFLKEKNKDIKVCVVEPAESAVLSGGEPGPHLIQGIGSGEIPTNLDL 240
145334565 160 YRTTGPEIWRDSAGKVDILVAGVGTGGTATGVGKFLKEQNKDIKVCVVEPVESPVLSGGQPGPHLIQGIGSGIVPFNLDL 239
42573493  160 YRTTGPEIWRDSAGKVDILVAGVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDL 239
79328865  160 YRTTGPEIWRDSAGKVDILVAGVGTGGTATGVGKFLKEQNKDIKVCVVEPVESPVLSGGQPGPHLIQGIGSGIVPFNLDL 239
79328884  160 YRTTGPEIWRDSAGKVDILVAGVGTGGTATGVGKFLKEQNKDIKVCVVEPVESPVLSGGQPGPHLIQGIGSGIVPFNLDL 239
15241111  160 YRTTGPEIWRDSAGKVDILVAGVGTGGTATGVGKFLKEQNKDIKVCVVEPVESPVLSGGQPGPHLIQGIGSGIVPFNLDL 239
15241112  160 YRTTGPEIWRDSAGKVDILVAGVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDL 239
18397061  161 YRTTGPEIWRDSAGEVDILVAGVGTGGTLSGSGRFLKEKNKDFKVYGVEPTESAVISGGKPGTHLIQGIGAGLIPDNLDF 240
30690901  160 YRTTGPEIWRDSAGKVDILVAGVGTGGTATGVGKFLKEQNKDIKVCVVEPVESPVLSGGQPGPHLIQGIGSGIVPFNLDL 239
297829006 161 YRTTGPEIWRDSAGEVDILVAGVGTGGTLSGSGRFLKEKNKDFKVYGVEPTESAVISGGKPGTHLIQGIGAGIIPDNLDF 240
297808839 160 YQTTGPEIWRDSAGKVDILVAGVGTGGTASGVGKFLKEQNKDIKVCVVEPEESPVLSGGQPGPHLIQGIGSGIIPFNLDL 239
297795639 161 YRTTGPEIWRDSAGKVDILVAGVGTGGTVTGTGKFLKEKNKDIKVCVVEPAESAVLSGGEPGPHLIQGIGSGEIPTNLDL 240
297813061 241 SIVDEIIQVTGEEAIETAKLLALKEGLLVGISSGASAAAALKVAKRPENAGKLIVVIFPSGGERYLSTELFESVRYEAEN 320
145334565 240 TIVDEIIQVAGEEAIETAKLLALKEGLLVGISSGAAAAAALKVAKRPENAGKLIVVVFPSGGERYLSTKLFDSIRYEAEN 319
42573493  240 SIVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSGGERYLSTELFESVRYEAEN 319
79328865  240 TIVDEIIQVAGEEAIETAKLLALKEGLLVGISSGAAAAAALKVAKRPENAGKLIVVVFPSGGERYLSTKLFDSIRYEAEN 319
79328884  240 TIVDEIIQVAGEEAIETAKLLALKEGLLVGISSGAAAAAALKVAKRPENAGKLIVVVFPSGGERYLSTKLFDSIRYEAEN 319
15241111  240 TIVDEIIQVAGEEAIETAKLLALKEGLLVGISSGAAAAAALKVAKRPENAGKLIVVVFPSGGERYLSTKLFDSIRYEAEN 319
15241112  240 SIVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSGGERYLSTELFESVRYEAEN 319
18397061  241 NVLDEVIQVTSVEAIETAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVIFPSGGERYLSTSLFESVRHEAEN 320
30690901  240 TIVDEIIQVAGEEAIETAKLLALKEGLLVGISSGAAAAAALKVAKRPENAGKLIVVVFPSGGERYLSTKLFDSIRYEAEN 319
297829006 241 SVLDELIQVTSVEAIETAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVIFPSGGERYLSTSLFESVRHEAEN 320
297808839 240 TIVDEIIKVTGEEAIETAKLLALKEGLLVGISSGAAAAAALKVAKRPENTGKLIAVVFPSGGERYLSTKLFDSVRYEAEN 319
297795639 241 SIVDEIIQVTGEEAIETAKLLALKEGLLVGISSGASAAAALKVAKRPENAGKLIVVIFPSGGERYLSTELFESVRYEAEN 320
297813061 321 LPVE 324
145334565 320 LPIE 323
42573493  320 LPVE 323
79328865  320 LPIE 323
79328884  320 LPIE 323
15241111  320 LPIE 323
15241112  320 LPVE 323
18397061  321 LPIQ 324
30690901  320 LPIE 323
297829006 321 LPIH 324
297808839 320 LPIE 323
297795639 321 LPVE 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap