Conserved Protein Domain Family
PHA03418

?
PHA03418: PHA03418 
hypothetical E4 protein; Provisional
Statistics
?
PSSM-Id: 177646
View PSSM: PHA03418
Aligned: 2 rows
Threshold Bit Score: 320.532
Threshold Setting Gi: 9628491
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
238801698  43 EILSIIMWYLLMMPVDTVNLASGRSELIRKLCLPLLPAPHHPNPQEDPDKNpsppPQPPPTPRPPAVPNGHNKPPVTKQP 122
9628491     1 GSLNIIMCCLLMMPIDTVNLANGRSGLIRKLCLPLSPAPHHPTPQEGPENY----PDPPLTPRPQAQPNSHNKPVVTKQP 76 
238801698 123 GKEGTEGDHQAPQAADGDDDPRPGKRSKAGGPKPGPGRGRlSPFKLDLdqDPLHGDPDPPQGAVGGQGSEPPEGGEESQP 202
9628491    77 SGRGTGEGSQAPLTPDADDDPRPGKRSKGDEHGPAPGRAA-APLKLDL--DPPQGGPDQPPGATGGVGETPPEGNEESQP 153
238801698 203 PLGEGEGQVEGHPPPLPPAPEPKPHNGDQTHGLLGTVACLLGTWEETFRQLVEDIQEDLDGYWRKLGIPQ 272
9628491   154 PPGEGEGAVEGHPPPPPPPPEPKPHNGDATHGLLGTVASLLGTWEESFRQLVEEIQEDLDDYWRRLSIPQ 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap