Conserved Protein Domain Family
PHA03417

?
PHA03417: PHA03417 
E4 protein; Provisional
Statistics
?
PSSM-Id: 177645
View PSSM: PHA03417
Aligned: 2 rows
Threshold Bit Score: 129.815
Threshold Setting Gi: 9629725
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629725   1 MVKHCNGKYVLTAQLYVLLHLYLVLCKKYPMLGLLHTPPplHRPPTQCRPVFQKNVCKRRLLNDNEDlhnlqekPNTP-A 79 
9626058   1 MGAPNIGKYVMAAQLYVLLHLYLALHKKYPFLNLLHTPP--HRPPPLCPQAPRKTQCKRRLGNEHEE-------SNSPlA 71 
9629725  80 TLCVTQTVQPLTVQTTTSTITVTAVTTDGTTVTVLVHL 117
9626058  72 TPCVWPTLDPWTVETTTSSLTITTSTKDGTTVTVQLRL 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap