Conserved Protein Domain Family
PHA03416

?
PHA03416: PHA03416 
hypothetical E4 protein; Provisional
Statistics
?
PSSM-Id: 177644
View PSSM: PHA03416
Aligned: 3 rows
Threshold Bit Score: 107.756
Threshold Setting Gi: 230238159
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
230241478  1 CVIPTLCLALPSANQYPLLKLLTDCNAAPHPTPTPAPAPRKTCGRKHRPQSDNDEQTRHPTPCGPWTVTADSCWLELRTT 80 
230235771  1 YIFPTLYLVLPSAPRYPLLRLLQDCNDPQRPHQRPHSCATQTGGSHRLPKSHEGKTQPTPTQCGPWTVTATPYSVELSLT 80 
230238159  1 SIIPTLCLALPSATHYPLLRLLTDCT-PAQPTPTPAPRAPKKTTEPHHHLPSDADQTLLQIQCGPWTVTASHYSLDLRTV 79 
230241478 81 TpQGTQIILTVHL 93 
230235771 81 Q-EGTTITVKLSL 92 
230238159 80 A-QGTQLTLTVRL 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap