Conserved Protein Domain Family
PHA03415

?
PHA03415: PHA03415 
putative internal virion protein; Provisional
Statistics
?
PSSM-Id: 177643
View PSSM: PHA03415
Aligned: 2 rows
Threshold Bit Score: 1722.18
Threshold Setting Gi: 281306694
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
281306694    4 SKGSLKPKVVVPADELqTALNPASPSGLSGDNTLVTGGPVGAAAeDKAVATAAAPLVEQKKDDNLSTTDKVVAAAQETYT 83  
158345182    1 MANPTPPKIQLSPEEF-AQVNAGAATSLTQDWSPVDQGLAGQIA-EREQLLRAQPLELAVADAKRSTWDTWQAGLQETET 78  
281306694   84 GYIVEAMDRSYSEQFNDFDPSFDGKRHALDLLNRLGVEPTEKHLEVLARAGTEENQIEQAQRMAQHKTNQEILSKHGAYA 163 
158345182   79 AYLLRAYLDDRDEMFPRHDPNFDIKREYGDILRAHGIQDTDDNLTALAKATSSEEASWIATGIADKEAREAILARHGVVA 158 
281306694  164 VASGVLDPAMLITDIATFGASKALSLGRLGAGALGATGATAYTYAADVSGKETQAFEYLLNASLVGGANALFAGgarlPN 243 
158345182  159 FTTGMVDPLTILADIATFGGTRALKMGRLSSAIAGGSSAVAVSAMADYAGKDYEALDYAINFGVTAGAFALVGG----RG 234 
281306694  244 LPGGLPGTGAAGTATGVRRSVNAFVSETDKL-AATPEAADVLRTLVDDPVRRSGLLTNNNAASFQRMYSNEADGLIKAYD 322 
158345182  235 LDGLRSQAGTPGAPGGMFSGLTNFLSETDKLiSPSAESAAVLANVVDDPVRRAGILTNDNAASTFRVNSNILDGTFAKWT 314 
281306694  323 DSVEQELSK--SFNWAQRKLDVSGRYADAKDALNSRVTDELLRRDDMWSRFGHVmPDPNVDPMIARLADQSDAFHGRLGE 400 
158345182  315 EGLEKTIAQreGLGTFSIKMDASGRYGEARDALERKVAEELARRDAEWTRFGAV-ADVRLDPDVKRLADEYEQMMTQGAE 393 
281306694  401 MARDAGVRGFEDFTARPGYFHRSWNDTLFQAAERS-EKGIVRKLLAESVERGIKgVDKDEADAIAGALVQRVHDKASGMR 479 
158345182  394 LAKRQGLAGFEDFTPRPGYFHRAWSESKIRALEDAyGRKTVKNLLTESIVRGLR-LTKKEAGLISTAILTRTRTKAAGLR 472 
281306694  480 SDFMGALGKADTTFLRESLEAAKVSAGRIESIMGKIEQKASDQGTSKYGKHRLTLDMSASVKAKDGTVYRVADLIDRDLD 559 
158345182  473 PEFMGALGKTDTDAIRTMLVEAGTDDATIKSVMGRIEQNLDEAGKSKYSKTRLPLDMTVKITTPDGRTISVLDMIDTDLS 552 
281306694  560 RIMENYGTSLSGRSALAKAGIAADDAGLEAFKRSYLASI--NKLPQAEQADLMQQLDGLLGDFTGHRPDANILGANAQRV 637 
158345182  553 RLAENYNQQMAGRSALSAAGVGGDDASIQALRGRYYDTLvnAKLTDADIDDRMLQFDHLMSDFTGNRPPGTVLGTTAQRA 632 
281306694  638 KSVADATMLSASGLWQVAEYATMAQRHGVVETGKEFMRRFPGIRNVLQSARTNPDLADELHTVLGLDLARDVRLRPWKRQ 717 
158345182  633 KSLAQSTMLAASGLWQVAEYGTLAYRHGAARTTAEFFKQFPGVAGLLRKAGRDPDLYDELSSVVGLDLARDVRVRPWLRQ 712 
281306694  718 HDAFLESSDTMVDRILHAGKQAVPYLNGMKFIHSHQSRMNANLVLNKFARAAQGDTKALAEIRKYA-PDLDWAQAEQAIK 796 
158345182  713 YEANLTSRDTLLDRVLYLGNQATPILNAMKFVHTHQVRLNANLTMNTIGRAAKGDRKALQMLREYGlDDTAWGKIKKAVD 792 
281306694  797 SNVTYVGKNAQEFNWSRWAPEDVDGVMNAALRMMDDAILYGRAGQGASFSRSQVGQVLGQFRSFVSFANNKLLRGTLNAD 876 
158345182  793 DNAEFNGKNVRSMNWDGWPQDAVDAALNVGARIMDDTILYGRSGQGSSFARSQLGQILGQFRSFVSFAHNKLLRGTIQNS 872 
281306694  877 GPKGLASLMAFQYPMTFLMVSVNEARKGQ-LDL-SEKGVKKMAKSAVGYTAALGFVGDAAGILGLTGGRGGLSTPLTGVF 954 
158345182  873 GYTGLAVLLAHQYPLTMMMVAANELRKGEsVDLeSEAGLMTLASKAIGYTAGIGFIGDAAGIVGLTGGRGGLSAPVLGLA 952 
281306694  955 DALPRATGGIAKVAgisrdtsgEYQGREGAADIGKAATMVVPFLNVMPGTAMALEALKD 1013
158345182  953 NAPGSIVQGTGHLL--------QGEGSEALADYMQAARTALPFVGVMPGTALLQNALKE 1003
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap