Conserved Protein Domain Family
PHA03414

?
PHA03414: PHA03414 
virion protein; Provisional
Statistics
?
PSSM-Id: 177642
View PSSM: PHA03414
Aligned: 6 rows
Threshold Bit Score: 2506.54
Threshold Setting Gi: 195546682
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225626364    1 MAKQFKGRMTPKYPLDQAQLDEAQVQGQLDAVSTVGFDALTGGEIGERNVAAGQRANARELERIVADQNLPALDRASALW 80  
33300848     1 MAKQFKGRMTPKYPLDQAQLDEAQVQGQLDAVPTVGFDALTGGEIGERNVAAGQRANARELERIVADQELPALDRASALW 80  
158345064    1 MAKQFKGRMTPKYPLDQAQLDEAQVQGQLDAVPTVGFDALTGGEIGERNVAAGQRANARELERIVADQELPALDRASALW 80  
195546682    1 --------MTPKYPLDQAQLDEAQVQGQLDAVPTVGFDALTGGEIGERNVAAGQRANARELERIVADQELPALDRASALW 72  
195546744    1 MAKQFKGRMTPKYPLDQAQLDEAQVQGQLDAVPTVGFDALTGGEIGERNVAAGQRANARELERIVADQELPALDRASALW 80  
167600483    1 MAKQFKGRMTPKYPLDQAQLDEAQVQGQLDAVPTVGFDALTGGEIGERNVAAGQRANARELERIVADQELPALDRASALW 80  
225626364   81 NQSTLVGRWGDSLQLDADLAANSTGEVDPNFDAGTYGVQALQAAGIQPTDNYLQIMARAGNAEDAAYLLSRIQRYEQDEQ 160 
33300848    81 NQSTLVGRWGDALQLDADLAANSTGEVDPNFDAGTYGVQALQAAGIQPTDNYLQIMARAGNAKDAAYLLSRIQRYEQDEQ 160 
158345064   81 NQSTLVGRWGDALQLDADLAANSTGEVDPNFDAGTYGVQALRAAGIQPTDNYLQIMARAGNAEDAAYLLSRIQRYEQDEQ 160 
195546682   73 NQSTLVGRWGDALQLDADLAANSTGEVDPNFDAGTYGVQALQAAGIQPTDNYLQIMARAGNAKDAAYLLSRIQRYEQDEQ 152 
195546744   81 NQSTLVGRWGDALQLDADLAANSTGEVDPNFDAGTYGVQALQAAGIQPTDNYLQIMARAGNAKDAAYLLSRIQRYEQDEQ 160 
167600483   81 NQSTLVGRWGDALQLDADLAANSTGEVDPNFDAGTYGVQALQAAGIQPTDNYLQIMARAGNAEDAAYLLSRIQRYEQDEQ 160 
225626364  161 IVRDNPYWNFAAGMLDPAALAVDAVTFGAGRVLRLGRAGMAAAGGAGQVGYVAGLDAAGADVDAGTYIVAGALGAGVGAL 240 
33300848   161 IVRDNPYWNFAAGMLDPAALAVDAVTFGAGRALRLGRAGMAAAGGAGQVGYVAGLDAAGADVDAGTYIVAGALGAGVGAL 240 
158345064  161 IVRDNPYWNFAAGMLDPAALAVDAVTFGAGRALRLGRAGMAAAGGAGQVGYVAGLDAAGADVDAGTYIVAGALGAGVGAL 240 
195546682  153 IVRDNPYWNFAAGMLDPAALAVDAVTFGAGRALRLGRAGMAAAGGAGQVGYVAGLDAAGADVDAGTYIVAGALGAGVGAL 232 
195546744  161 IVRDNPYWNFAAGMLDPAALAVDAVTFGAGRALRLGRAGMAAAGGAGQVGYVAGLDAAGADVDAGTYIVAGALGAGVGAL 240 
167600483  161 VVRDNPYWNFAAGMLDPAALAVDAVTFGAGRALRLGRAGMAAAGGAGQVGYVAGLDAAGADVDAGTYIVAGALGAGVGAL 240 
225626364  241 LGSGAGRIAAEAPTQPHVPEVSAPTVGLPEVAMTAEEAAARGFKAGDVVDLLDEGTVLSRVSSRVEQAEIPAIPRRDTAF 320 
33300848   241 LGSGAGRIAAEAPTQPHVPEVSAPTVGLPEVAMTAEEAAARGFKAGDVVDLLDEGTVLSRISARVEQAEIPAIPRRDTAF 320 
158345064  241 LGSGAGRIAAEAPTQPHVPEVSAPTVGLPEVAMTAEEAAARGFKAGDVVDLLDEGTVLSRVSARVEQAEIPAIPRRDTAF 320 
195546682  233 LGSGAGRIAAEAPTQPHVPEVSAPTVGLPEVAMTAEEAAARGFKAGDVVDLLDEGTVLSRISARVEQAEIPAIPRRDTAF 312 
195546744  241 LGSGAGRIAAEAPTQPHVPEVSAPTVGLPEVAMTAEEAAARGFKAGDVVDLLDEGTVLSRISARVEQAEIPAIPRRDTAF 320 
167600483  241 LGSGAGRIAAEAPTQPHVPEVSAPTVGLPEVAMTTEEAAARGFKAGDVVDLLDEGTVLSRVSAKVEQAEIPAIPRRDTAF 320 
225626364  321 GDELHGLSGRKLSEVVDHLKTHAEVPKPLQGVAAKVAETLKTLEGLGQRTMFRVVQGGDTASSAFLKPSTAGLHSTQGLD 400 
33300848   321 GDELHSLSGRKLSEVVDHLKTHAEVPKPLQGIAAKVADTLKTLEGLGQRTAFRVVQGGDTASSAFLKPGTAGLHSTQGLD 400 
158345064  321 GDELHSLSGRKLSEVLDHLKTHAEVPKPLQGIAAKVADTIRTLEGLGQRTAFRVVQGGDTASSAFLKPGTAGIHSTQGLD 400 
195546682  313 GDELHSLSGRKLSEVVDHLKTHAEVPKPLQGIAAKVADTLKTLEGLGQRTAFRVVQGGDTASSAFLKPGTAGLHSTQGLD 392 
195546744  321 GDELHSLSGRKLSEVVDHLKTHAEVPKPLQGIAAKVADTLKTLEGLGQRTAFRVVQGGDTASSAFLKPGTAGLHSTQGLD 400 
167600483  321 GDELHSLSGRKLSEVLDHLKTHAEVPKPLQGIAAKVADTIRTLESLGQRTAFRVVQGGDTASSAFLKPGTAGIHSTQGLD 400 
225626364  401 TLVQVRGSTAPGRVGTNPVTVLHEAVHAATVGVMNTALRNPGAMTPKVAQAMQTLENVRGNVLNALKQDRAAGRQLSEFE 480 
33300848   401 TLVQVRGSTAPGRVGTNPVTVLHEAVHAATVGVMNAALRNPGAMSPKVAQAMQTLENVRGNVLNALKQDRAAGRQLSEFE 480 
158345064  401 TLVQVRGSTAPGRVGTNPVTVLHEAVHAATVGVMNAALRNPGAMSPKVAQAMQTLENVRGNVLNALKQDRAAGRQLSEFE 480 
195546682  393 TLVQVRGSTAPGRVGTNPVTVLHEAVHAATVGVMNAALRNPGAMSPKVAQAMQTLENVRGNVLNALKQDRAAGRQLSEFE 472 
195546744  401 TLVQVRGSTAPGRVGTNPVTVLHEAVHAATVGVMNAALRNPGAMSPKVAQAMQTLENVRGNVLNALKQDRAAGRQLSEFE 480 
167600483  401 TLVQVRGSTAPGRVGTNPVTVLHEAVHAATVGVMNAALRNPGAMSPKVAQAMQTLENVRGNVLNALKQDRAAGRQLSEFE 480 
225626364  481 ETLLAGNSNTLANVKELVAWGLTDTRFQKTLNRLRYGDGGKGLWSRFVEGIRSLLGLRPDADTALSRVLAASETIMDAMP 560 
33300848   481 ETLLAGNSNTLANVKELVAWGLTDTRFQRTLNRLRYSDGGPGLWSRFVEGIRSLLGLRSDADTALSRVLAASETIMDAMP 560 
158345064  481 ETLLAGNSNTLANVKELVAWGLTDTRFQRTLNRLRYSDGGPGLWSRFVEGIRTLLGLRSDADTALSRVLAASETIMEAMP 560 
195546682  473 ETLLAGNSNTLANVKELVAWGLTDTRFQRTLNRLRYSDGGPGLWSRFVEGIRSLLGLRSDADTALSRVLAASETIMDAMP 552 
195546744  481 ETLLAGNSNTLANVKELVAWGLTDTRFQRTLNRLRYSDGGPGLWSRFVEGIRSLLGLRSDADTALSRVLAASETIMDAMP 560 
167600483  481 ETLLAGNSNTLANVKELVAWGLTDTRFQRTLNRLRYSDGGPGLWSRFVEGIRTLLGLRSDADTALSRVLAASETIMEAMP 560 
225626364  561 GYTKAQAKWANKGAPVTEEASLETIVRSTRERAREGAGFVNRFFSEADLLAQPGEGARRLLSRLIDDPVRRDGFSTNDNA 640 
33300848   561 GYTKAQAKWANKGAPVTEEASLETIVQSTRERAREGAGFVNRFFSEADLLAQPGEGARRLLGRLIDDPVRRDGFSTNDNA 640 
158345064  561 GYTKAQAKWANKGAPVTEEASLETIVRATRERAREGAGFVNRFFSEADLLAQPGEGARRLLSRLIDDPVRRDGFSTNDNA 640 
195546682  553 GYTKAQAKWANKGAPVTEEASLETIVQSTRERAREGAGFVNRFFSEADLLAQPGEGARRLLGRLIDDPVRRDGFSTNDNA 632 
195546744  561 GYTKAQAKWANKGAPVTEEASLETIVQSTRERAREGAGFVNRFFSEADLLAQPGEGARRLLGRLIDDPVRRDGFSTNDNA 640 
167600483  561 GYTKAQAKWANKGAPVTEEASLETIVRSTRERAREGAGFVNRFFSEADLLAQPGEGARRLLSRLIDDPVRRDGFSTNDNA 640 
225626364  641 ASYLRRYRNEFEGYVKSYDEMMAKAMAEQGVGLTARALNSRRAMAVRDQLNEQVTRELLRRDREWTAYGSVRVDPNLPAT 720 
33300848   641 ASYLRRYRNEFEGYVKSYDEMMAKAMAEQGVGLTARALNSRRAMAVRDQLNEQVTRELLRRDREWTAYGSVRVDPNLPPT 720 
158345064  641 ASYLRRYRNEFEGYVKSYDEMMAKAMAEQGVGLTARALNSRRAMAVRDQLNEQVTRELLRRDREWTAYGSVRVDPSLSPT 720 
195546682  633 ASYLRRYRNEFEGYVKSYDEMMAKAMAEQGVGLTARALNSRRAMAVRDQLNEQVTRELLRRDREWTAYGSVRVDPNLPPT 712 
195546744  641 ASYLRRYRNEFEGYVKSYDEMMAKAMAEQGVGLTARALNSRRAMAVRDQLNEQVTRELLRRDREWTAYGSVRVDPNLPPT 720 
167600483  641 ASYLRRYRNEFEGYVKSYDEMMAKAMAEQGVGLTARALNSRRAMAVRDQLNEQVTRELLRRDREWTAYGSVRVDPNLPPT 720 
225626364  721 IKALADHSDEIHGLMGQRAREAGVRGFENFAPRPGYFHRSWNWSKMAQMDEAAPGLARRAISEAVFRGIPGLERADADTI 800 
33300848   721 IKALADRSDEIHGLMGQRAREAGVRGFEDFAPRPGYFHRSWNWSKMAQMDEAAPGLARRAISEAVFRGIPGLDRADADTI 800 
158345064  721 IKALADRSDEIHGLMGQRAREAGVRGFEDFAPRPGYFHRSWNWSKMAQMDEAAPGLARRAISEAVFRGIPGLERADADTI 800 
195546682  713 IKALADRSDEIHGLMGQRAREAGVRGFEDFAPRPGYFHRSWNWSKMAQMDEAAPGLARRAISEAVFRGIPGLDRADADTI 792 
195546744  721 IKALADRSDEIHGLMGQRAREAGVRGFEDFAPRPGYFHRSWNWSKMAQMDEAAPGLARRAISEAVFRGIPGLDRADADTI 800 
167600483  721 IKALADRSDEIHGLMGQRAREAGVRGFENFAPRPGYFHRSWNWSKMAQMDEAAPGLARRAISEAVFRGIPGLERADADTI 800 
225626364  801 AQAIVQRARDRATGIRSEFMGAMGVADTAFIRQALEEANVSQAKFDSIMAKIEQKQSDQGTVKYGKGRLSLDMTAEINHN 880 
33300848   801 AQAIVQRARDRATGIRSEFMGAMGVADTAFIRQALEEANVSQAKFDSIMAKIEQKQSDQGTVKYGKGRLSLDMTAEINHN 880 
158345064  801 AQAIVQRARDRATGIRSEFMGAMGVADTAFIRQALEEANVSQVKFDSIMAKIEQKQSDQGTVKYGKGRLSLDMTAEINHN 880 
195546682  793 AQAIVQRARDRATGIRSEFMGAMGVADTAFIRQALEEANVSQAKFDSIMAKIEQKQSDQGTVKYGKGRLSLDMTAEINHN 872 
195546744  801 AQAIVQRARDRATGIRSEFMGAMGVADTAFIRQALEEANVSQAKFDSIMAKIEQKQSDQGTVKYGKGRLSLDMTAEINHN 880 
167600483  801 AQAIVQRARDRATGIRSEFMGAMGVADTAFIRQALEEANVSQAKFDSIMAKIEQKQSDQGTVKYGKGRLSLDMTAEINHN 880 
225626364  881 GTVYRVQDLIDRDLDRLMENYSGSMSGRSALARAGMPGDSEVEAFIREYQREAAHLGTDKVQELTGQLRGVFGDFTGNVP 960 
33300848   881 GTVYRVQDLIDRDLDRLMENYAGSMSGRSALARAGMPGDSEIEAFIREYQREAAHLGTDKVQELTGQLRGVFGDFTGNVP 960 
158345064  881 GTVYRVQDLIDRDLDRLMENYAGSMSGRSALARAGMPGDSEIEAFIREYQREAAHLGTDKVQELTGQLRGVFGDFTGNVP 960 
195546682  873 GTVYRVQDLIDRDLDRLMENYAGSMSGRSALARAGMPGDSEIEAFIREYQREAAHLGTDKVQELTGQLRGVFGDFTGNVP 952 
195546744  881 GTVYRVQDLIDRDLDRLMENYAGSMSGRSALARAGMPGDSEIEAFIREYQREAAHLGTDKVQELTGQLRGVFGDFTGNVP 960 
167600483  881 GTVYRVQDLIDRDLDRLMENYAGSMSGRSALARAGMPGDSEIEAFIREYQREAAHLGTDKVQELTGQLRGVFGDFTGNVP 960 
225626364  961 REHQLGPVAQRASGLTSATMLGFSGVYQLAELATMAHRQGVFNVMKAMMNSRLGDFVGAMRRNPDLADEMQTVLGLNLAN 1040
33300848   961 REHQLGPVAQRASGLTSATMLGFSGVYQLAELATMAHRQGVFNVMKAMLNSRMGDFVGAMRRNPDLADEMQTVLGLNLAN 1040
158345064  961 REHQLGPVAQRASGLTSATMLGFSGVYQLAELATMAHRQGVFNVMKAMLNSRMGDFVGAMRRNPDLADEMQTVLGLNLAN 1040
195546682  953 REHQLGPVAQRASGLTSATMLGFSGVYQLAELATMAHRQGVFNVMKAMLNSRMGDFVGAMRRNPDLADEMQTVLGLNLAN 1032
195546744  961 REHQLGPVAQRASGLTSATMLGFSGVYQLAELATMAHRQGVFNVMKAMLNSRMGDFVGAMRRNPDLADEMQTVLGLNLAN 1040
167600483  961 REHQLGPVAQRASGLTSATMLGFSGVYQLAELATMAHRQGVFNVMKAMLNSRLGDFVGAMRRDPDLADEMQTVLGLNLAN 1040
225626364 1041 DIRMKPWKRQFDTFLASQDTFMDRFLHAGKQAVPVLNGMKFIHNWQSRMNANLTLNKVARAAQGDEAALRVLQQYGKDVD 1120
33300848  1041 DIRMKPWKRQFDTFLASQDTFMDRFLHAGKQAVPVLNGMKFIHNWQSRMNANLTLNKVARAAQGDEAALRVLQQYGKDVD 1120
158345064 1041 DIRMKPWKRQFDTFLASQDTFMDRFLHAGKQAVPVLNGMKFIHNWQSRMNANLTLNKVARAAQGDEAALRVLQQYGKDVD 1120
195546682 1033 DIRMKPWKRQFDTFLASQDTFMDRFLHAGKQAVPVLNGMKFIHNWQSRMNANLTLNKVARAAQGDEAALRVLQQYGKDVD 1112
195546744 1041 DIRMKPWKRQFDTFLASQDTFMDRFLHAGKQAVPVLNGMKFIHNWQSRMNANLTLNKVARAAQGDEAALRVLQQYGKDVD 1120
167600483 1041 DIRMKPWKRQFDTFLASQDTFMDRFLHAGKQAVPVLNGMKFIHNWQSRMNANLTLNKVARAAQGDEAALRVLQQYGKDVD 1120
225626364 1121 WTPVLARVRGYVTYRGRNAQSMNWGAWSQADVNTVMNTALRIMDDSLLYGRVGQNSGFARSPVGQILGQFRSFVAFAHNK 1200
33300848  1121 WTPVLARVRGYVTYRGRNAQSMNWGAWSQADVNTVMNTALRIMDDSLLYGRVGQNSGFARSPVGQILGQFRSFVAFAHNK 1200
158345064 1121 WTPVLARVRGYVTYRGRNAQSMNWGAWSQADVNTVMNTALRIMDDSLLYGRVGQNSGFARSPVGQILGQFRSFVAFAHNK 1200
195546682 1113 WTPVLARVRGYVTYRGRNAQSMNWGAWSQADVNTVMNTALRIMDDSLLYGRVGQNSGFARSPVGQILGQFRSFVAFAHNK 1192
195546744 1121 WTPVLARVRGYVTYRGRNAQSMNWGAWSQADVNTVMNTALRIMDDSLLYGRVGQNSGFARSPVGQILGQFRSFVAFAHNK 1200
167600483 1121 WTPVLARVRGYVTYRGRNAQSMNWGAWSQADVNTVMNTALRIMDDSLLYGRVGQNSGFARSPVGQILGQFRSFVAFAHNK 1200
225626364 1201 LLRGTYENSGVLGVASLLAFQYPLTALMMGAKAAINGKFDTSDEGIRKMAIDGIGYTAGLGFTADMWGVVTGHSRMSAPV 1280
33300848  1201 LLRGTYENSGVLGVASLLAFQYPLTALMMGAKAAINGKFDTSDEGIRKMAIDGIGYTAGLGFTADMWGVVTGHSRMSAPV 1280
158345064 1201 LLRGTYENSGVLGVASLLAFQYPLTALMMGAKAAINGKFDTSDEGIRKMAIDGIGYTAGLGFTADMWGVVTGHSRMSAPV 1280
195546682 1193 LLRGTYENSGVLGVASLLAFQYPLTALMMGAKAAINGKFDTSDEGIRKMAIDGIGYTAGLGFTADMWGVVTGHSRMSAPV 1272
195546744 1201 LLRGTYENSGVLGVASLLAFQYPLTALMMGAKAAINGKFDTSDEGIRKMAIDGIGYTAGLGFTADMWGVVTGHSRMSAPV 1280
167600483 1201 LLRGTYENSGVLGVASLLAFQYPLTALMMGAKAAINGKFDTSDEGIRKMAIDGIGYTAGLGFTADMWGVITGHSRMSAPV 1280
225626364 1281 FGLAEHSNEVFRGVKDLVTGDDPAAATGDIVSGAAGALPFVNVFPATKLLLESIKGE 1337
33300848  1281 FGLAEHSNEVFRGVKDLVTGDDPAAATGDIVSGAAGALPFVNVFPATKLLLESIKGE 1337
158345064 1281 FGLAEHSNEVFRGVRDLVTGDDPAAATGDIVNGATGALPFVNVFPATKLLLESIKGE 1337
195546682 1273 FGLAEHSNEVFRGVKDLVTGDDPAAATGDIVSGAAGALPFVNVFPATKLLLESIKGE 1329
195546744 1281 FGLAEHSNEVFRGVKDLVTGDDPAAATGDIVSGAAGALPFVNVFPATKLLLESIKGE 1337
167600483 1281 FGLAEHSNEVFRGVKDLVTGDDPAAATGDIVNGAAGALPFVNVFPATKLLLESIKGE 1337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap