Conserved Protein Domain Family
PHA03413

?
PHA03413: PHA03413 
putative internal core protein; Provisional
Statistics
?
PSSM-Id: 177641
View PSSM: PHA03413
Aligned: 2 rows
Threshold Bit Score: 2199.49
Threshold Setting Gi: 282554625
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
229604958    1 MAIFQNRRPSSQgaglesNAKGVNGADMDAGA--LAWEDTTDLGLNAAEREANLKRLETPKATGLESFAAGVGNSIVGAA 78  
282554625    1 MAQFLNQEPNPQ------EKDSAKGATLKPAPerIDWNDAGDNGLNALERASLLAQAKTPATTTSESFASGMGNSIIAAA 74  
229604958   79 VRKATMPDFPEDTSFDLGTTMTADTSLRVLGYSEEELNFIGGSRSLDEYQYRKEAVEDQRKRDGVQAENMFAGIAGNLAG 158 
282554625   75 IRKASAPAFDRDPNFNAKQTLSSDTRAKLYAPNQEEIEYLHDSVSVEDYNYRMQQMLEQRDRDRLMADNTVAGFAGMLVG 154 
229604958  159 DAPFLLAPMGAAGVVGRTGMAVRAALRAGELATTYYAQDQLGQAEWVTAVAAGLIGVDQLYDVSRATRGvraaanaaeve 238 
282554625  155 DSPFILAPMSAAGIAGRAGLAARTAIRAADVGSAFYAQDQLGQSAAVTALIAGVAGLDQLWDMSRAAKA----------- 223 
229604958  239 sralgsatehvftaetglARKAQTGgvlsdapeivpdvvkpevaAQRMPDPDAPVNEVPEVVKVPRTGKGERsfpLQDTP 318 
282554625  224 ------------------AAKARTG-------------------REPMFDPEAPTTRTARDANVTGVGEGEE---ILTKT 263 
229604958  319 VEGRIVASRQGRKTVQIKAQDLVTHLRTMDSLSDSARALMDALPDTISGMEVRLMNATGRRSSYTFG----ANTEFLKLR 394 
282554625  264 LDESIQVSRNNTASVNMKAQHVVQFLKNSEHLTAGQKAILDTLGDAVNDIDFKLVAGSANRSRYTYAqqdlAKRGEISLR 343 
229604958  395 STAK-DGTVFKTVGDMLNHVDAD---VAVHELIHAVTSKTLfqaskgNVAPEIAdaiRDLDALHASLKNNREFARKYSYA 470 
282554625  344 APKQaNGSTWTTVGDALRAMDADtsrVAVHELIHAATARAI------DSNPEIA---KRLEEVRAVIAADSTLTPRMRYY 414 
229604958  471 MTNNREFLAELASKPEMVKDLAKLPGvRAGQNALQAVAEKILKMLGFKGTGSALDEAVDAFVKVANYQA-DNLDKVNAFF 549 
282554625  415 ASNVHEMLAGLGDSPEWVEHLVRTQS-PTGKSMLRQLGEYIMNALGIKAKGSALEDVLDAYEDAVKWTAkDYADQAQSFR 493 
229604958  550 SDGMADLADDANrgATAVERAKRLEQGVRKSLKQSFALWDNIARGSEDLANLLVSDATRMGERATSVVDHKRNLTLEQNL 629 
282554625  494 SEAFQDLVDSTT--LNEAKRAQAMLDGAKKKLSTMFALYDNIAQGNEDLAKLLVSDASAVGGRRPSVVDYKRNLTLEMDA 571 
229604958  630 RAAAVEDALVAAMREKhGVNTFDMFFNRAKARTARSVEEDKLTKYLHEAYSAEKAGREIPTPPADIERLVKAYTDSGWAE 709 
282554625  572 RASVVEDAILGALKDK-GIGVLSRFFHRSNFRAERAALEDRLSKYLDAAYSADVNGRAVPVPDAEIAPLVDAYRRSGWAS 650 
229604958  710 SWHEHLVKSGTISADEFPRSKYYIPRQYSYEKVRN-----IEPPKVKKLLRSALQDTYTNMDGKLAARVADSWYNRIVNG 784 
282554625  651 KWHEHMLNAGLVDDGALVKSDYYFPRQYSYDKMRQgiaqgNTLDDYRALFRFALRDVYPSMESEVVQRVAKEMVDGIYNG 730 
229604958  785 VSGSGGPQWKNLMQGMDNDELFMALRDAGVEDDKINEFLRVNVPKTGSTAPVKNLRNRLDLNLNKEFDIDGDVLRLSDIL 864 
282554625  731 RAGQSGPMWKQLINGMGNDEVVMAMRSAGVDESAIQSFLAGNVRESGSTSPARNLRQRTRFNMDKEYLVNGKSMRMQDLM 810 
229604958  865 ETNTLGLMQGYTNRMSGRVAFANRGITDLRALDRSITETRLGMGEGAEsWGKAVDDTIDHLLGYPVGT--DIPELMRGAS 942 
282554625  811 DTDVAKVMHGYTNRMSGRVGMAYAGVQDLGQLSKMIDESKHALADSAK-WEKTVNDTIDFILGGAPADsgQLPGLLRAAG 889 
229604958  943 NLANTVMLKNSGLYQMTDISIAMKEFGLARVLRGLASTGLLRKADAVVADTGSRERLYSILNGAYQNEARYRHIHTYADD 1022
282554625  890 NMANATMLKNSGLYQLTDTALAMKEFGMARVLRSMRDQPWFKEGVVAIKTPDMAARLDTVLRGNIQKEMRFRWLNTYADD 969 
229604958 1023 NLDLTNTSAAFQTTQNLSQAARLANGFSMVHRLMANLNAGIICDEVENVLKGGSS--RALSEHGLTPELTQQLRAAYAEN 1100
282554625  970 NLDLTRQASWFNVTQNVGQAARHVNGMSMVHRLQVNLNSGIVADELTQMFKGDAEafKRLERFGLTREIADRAIAANKAN 1049
229604958 1101 PTGLLPYELQRELEIVSTRAMDSVMQNIRTGETSHFAQFSPVGKIVVGYQSFAIAATNKLLRRYTQNGDYAGLAMLMMYQ 1180
282554625 1050 PGAMFQPDLQMQIEVVGTRMMDYLVQQIRTGETSHFAQFNPIGKVIVGYQSFALAATNKILRRELNDAGWIGVAHIMAYQ 1129
229604958 1181 FPLMLMATHAKLALDGKEAQSPReLITNTAMNMSAIGGVTLLSPLFLGESPRHSLTSLGYVTQSIGAVQDMVSdGRMDTQ 1260
282554625 1130 FPLMLLATMAKHSMDGKDVDTQK-LISESVLGMSAIGGVSLLQDIFLGDSPRHSLASMSYVTGLLGAVQDLVT-GNMDIK 1207
229604958 1261 RMSKILPFAQEFMPLRAVINNMGE 1284
282554625 1208 TFTKQVPLIQEFAPTRAIINNFGD 1231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap