Conserved Protein Domain Family
PHA03412

?
PHA03412: PHA03412 
putative methyltransferase; Provisional
Statistics
?
PSSM-Id: 177640
View PSSM: PHA03412
Aligned: 3 rows
Threshold Bit Score: 488.76
Threshold Setting Gi: 66391481
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
304373584   1 MESDKALTYDEKLFIIENFHEGAFTNNSELGAFFTPIGLARDFTIDACTSGSVVDLCAGIGGLSFAMLHMMMYAKPREIV 80 
66391481    4 VESDKALTYEEKLFIIENFHEGAFTNNSELGAFFTPIGLARDFTIDACTSGSVVDLCAGIGGLSFAMIHMMMYAKPREIV 83 
294661448  19 VHSDKALTYEEKLFIIENFHEGAFTNNSELGAFFTPIGLARDFTIDACTGGSVIDLCAGIGGLSFAMVHYMMYNTPREIV 98 
304373584  81 CVELNHTYYKLGKRIVPEATWINADALTTEFDTLFDMAISNPPFGKIKTSDFKGKYTGAEFEYKVIERASQIARMGTFIL 160
66391481   84 CVELNHTYYKLGKRIVPEATWINADALTTEFDTLFDMAISNPPFGKIKTSDFKGKYTGAEFEYKVIERASQIARAGTFII 163
294661448  99 CVELNHTYYELGKRIVPEASWVHGDALTTEFNQVFDMAISNPPFGKIKTSDFKGKYTGAEFEYKVIERASQIARQGTFII 178
304373584 161 PQMSANFRYSGERYFRQDESTTSSKCKKFLDETGLEMQPGCGIDTGYYLEDWKGVKPLCEIVCMEFPEPEtkPAQNLFTF 240
66391481  164 PQMSANFRYSGAQYFQQNESTTSSKCKKFLDETGLEMHPGCGVDTSYYLEDWKGVKPLCEVVCMEFNEPE--PAQNLFTF 241
294661448 179 PQMSANFRYSKTHCFRQDDSTTSSKCKKFLDETGLVMNPGCGIDTGYYLEDWKGVKPLCEVVCMEF-EPE--TKSDLFTF 255
304373584 241 TIE 243
66391481  242 TIE 244
294661448 256 TIE 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap