Conserved Protein Domain Family
PHA03411

?
PHA03411: PHA03411 
putative methyltransferase; Provisional
Statistics
?
PSSM-Id: 177639
View PSSM: PHA03411
Aligned: 3 rows
Threshold Bit Score: 588.221
Threshold Setting Gi: 33620521
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
238695024   1 MARLSKQEQKLHDRVMELINSDRPLTYEEKEFCYNNYHGDGLGGSGAFFTPEGLAWDFTIDAHCTGKVLDLCAGIGRLSF 80 
157311444   1 MARLSKQEQKLHNRAMELINSDRPLTYEEKEFCYNNYHGDGLGGSGAFFTPEGLAWDFTIDAHCTGKVLDLCAGIGRLSF 80 
33620521    1 MARLSKQEQKLHDRVMELINSDRQLTYEEKEFCYNNYHGDGLGGSGAFFTPEGLAWDFTIDAHCTGKVLDLCAGIGRLSF 80 
238695024  81 CMLHRCKPEKIVCVELNPEFARIGKRLLPEAEWITSDVFEFESNEKFDVVISNPPFGKINTTDTKDVFEYTGGEFEFKVM 160
157311444  81 CMLHRCKPEKIVCVELNPEFARIGKRLLPEAEWITSDVFEFESNEKFDVVISNPPFGKINTTDTKDVFEYTGGEFEFKVM 160
33620521   81 CMLHRCKPEKIVCVELNPEFARIGKRLLPEAEWITSDVFEFESNEKFDVVISNPPFGKINTTDTKDVFEYTGGEFEFKVM 160
238695024 161 TLGQKFADVGYFIVPTGSAGFAYSGRPYYDGSMKSNKYLKWSKQTGLVTYAGCGIDTSIYRDEWHSTNVLTEVVEVRYYE 240
157311444 161 TLGQKFADVGYFIVPSGSAGFAYSGRPYYDGTMKSNKYLKWSKQTGLVTYAGCGIDTSIYRDEWHSTNVLTEVVEVRYYE 240
33620521  161 TLGQKFADVGYFIVPTGSAGFAYSGRPYYDGTMKSNKYLKWSKQTGLVTYAGCGIDTSIYRDEWHSTSVLTEVVEVRYYE 240
238695024 241 KEAVEAPKSRPNEQIEESKEITLPKQESESGTLSDLFDI 279
157311444 241 KEAVEAPKSRPNEQIEESKEITLPKQESESGTLSDLFDI 279
33620521  241 KEAVEAPKSRPNEQIEESKEITLPKQESESGTLSDLFDI 279
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap