Conserved Protein Domain Family
polh

?
PHA03389: polh 
polyhedrin; Provisional
Statistics
?
PSSM-Id: 177625
View PSSM: PHA03389
Aligned: 40 rows
Threshold Bit Score: 433.042
Threshold Setting Gi: 110645210
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195404   1 MYTRYSyspALGRTYVYDNKYYKNLGHVIKAAKRTKHHEENEVAERAYDSLDKYLVAEDPFLGPGKNQKLTLFKEIRNVK 80 
110645210   4 LAAGYQ---TSAKSYIYDNKYYRGLGDIINSAKKRKHDQDWEKHAEERRALNGFILPLDPRTGPGKHVKMVMFQEVRNIK 80 
119964535   1 -MPDYSyrpTVGRTYVYDNKYYKNLGSVIKNAKRKKHLVEHEEEEKHWDPLDNYMVAEDPFLGPGKNQKLTLFKEIRIVK 79 
96979770    1 -MPDYSyrpTIGRTYVYDNKYYKNLGSVIKNAKRKKHLVEHEEEEKHWDPLDNYMVAEDPFLGPGKNQKLTLFKEIRNVK 79 
86355521    1 -MPDFSyrpTIGRTYVYDNKYYKNLGSVIKNAKRKKHLLEHEADEKFLDPLDHYMVAEDPFLGPGKNQKLTLFKEIRNVK 79 
48843630    5 LAAGYQ---TSAKSYIYDNKYYRGLGDIINSAKKRKHDQDWEKHAEERRALNGFILPLDPRTGPGKHVKMVMFQEVRNIK 81 
23577889    1 -MPDYSyrpTIGRTYVYDNKYYKNLGSVIKNAKRKKHLIEHEEEEKHLDPLDNYMVAEDPFLGPGKNQKLTLFKEIRNVK 79 
9630817     1 -MPNYSytpTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVK 79 
9630967     1 MHNFYNyspALGKTYVYDNKYYKNLGTVIKQAKRQKHLEQHEIEERSLDHLDRYLVAEDPFYGPGKNQKLTLFKEIRNVK 80 
237643550   1 -MPNYSytpTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVK 79 
113195404  81 PDTMKLVVNWSGKEFLRETWTRFMEDSFPIVNDQEIMDVFLVINLRPTKPNRCYRFLAQHALRCDPDYVPHEVIRIVEPS 160
110645210  81 ANTMKLAINWSGREYLREVWTTFIEDTFPINNYQEFTDVFLEIRCTPNKSNRHYRFLAQHGLRMDEDFVPCDTIRVIEPE 160
119964535  80 PDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVFLVVNLRPTRPNRCYKFLAQHALRWDCDYVPHEVIRIVEPS 159
96979770   80 PDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVFLVINLRPTRPNRCYKFLAQHALRWDCDYVPHEVIRIVEPS 159
86355521   80 PDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVFLVINLRPTRPNRCYKFLAQHALRWDDNYVPHEVIRIVEPS 159
48843630   82 ANTMKLAINWSGREYLREVWTTFIEDTFPINNYQEFTDVFLEIRCTPNKSNRHYRFLAQHGLRMDEDFVPCDTIRVIEPE 161
23577889   80 PDTMKLIVNWSGKEFMRETWTRFVEDSFPIVNDQEVMDVFLVVNLRPTRPNRCYKFLAQHALRWDEDYVPHEVIRIVEPS 159
9630817    80 PDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPS 159
9630967    81 PDTMKLVVNWSGKEFLRETWTRFMEDSFPIVNDQEVMDIYLTINVRPTRPNRCYKFVAQHALRCDEGYVPHEVIRIVEPS 160
237643550  80 PDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPS 159
113195404 161 YVgSHNEYRISLAKRGGGCPVMNLHSEYTN-SFEEFIHKVIWENFYKPIVYIGTDSAEEEEILMEVSLVFKIKEFAPDAP 239
110645210 161 YL-QGNTVSLSLLKRDGGCPMMKIRQQFNElDLEQFVDRILWCHFHRPIVYIGTDSGEEEEVFIEASLTFIIKEFAPEAP 239
119964535 160 YVgMNNEYRISLAKKGGGCPIMNIHSEYTN-SFETFVNRVIWENFYKPIVYIGTDSGEEEEILIEVSLVFKVKEFAPDAP 238
96979770  160 YVgMNNEYRISLAKKGGGCPIMNIHSEYTN-SFESFVNRVIWENFYKPIVYIGTDSGEEEEILIEVSLVFKVKEFAPDAP 238
86355521  160 YVgMNNEYRISLAKRGGGCPIMNIHSEYTN-SFEQFVNRVIWENFYKPIVYIGTDSGEEEEILIEVSLVFKVKEFAPDAP 238
48843630  162 YL-QGNTVSLSLLKRDGGCPMMKIRQQFNElDLEQFVDRILWCHFHRPIVYIGTDSGEEEEVFIEASLTFIIKEFAPEAP 240
23577889  160 YVgMNNEYRISLAKKGGGCPIMNIHSEYTN-SFESFVSRVIWENFYKPIVYIGTDSGEEEEILIEVSLVFKVKEFAPDAP 238
9630817   160 YVgMNNEYRISLAKKGGGCPIMNIHSEYTN-SFESFVNRVIWENFYKPIVYIGTDSAEEEEILIEVSLVFKIKEFAPDAP 238
9630967   161 TV-ENNEYRISLAKRGGGCPIRNLHSAYTT-SFEHFLNSVIWDNFYKPIVYVGTTSAEEEEILLEVSLVFKIKEFAPDAP 238
237643550 160 YVgMNNEYRISLAKKGGGCPIMNIHSEYTN-SFESFVNRVIWENFYKPIVYIGTDSAEEEEILIEVSLVFKIKEFAPDAP 238
113195404 240 LYTGPAY 246
110645210 240 FVNGPGM 246
119964535 239 LFTGPAY 245
96979770  239 LFTGPAY 245
86355521  239 LFTGPAY 245
48843630  241 FVNGPGM 247
23577889  239 LFTGPAY 245
9630817   239 LFTGPAY 245
9630967   239 LFQGPAY 245
237643550 239 LFTGPAY 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap