Conserved Protein Domain Family
ORF1_granulin

?
PHA03388: ORF1_granulin 
Granulin; Provisional
Statistics
?
PSSM-Id: 177624
View PSSM: PHA03388
Aligned: 12 rows
Threshold Bit Score: 543.774
Threshold Setting Gi: 288804640
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148368822   1 MGYNRSLRYSRHNGTTCVIDNKHLKSLGSILGDVRRKKDLIREaAEFDPVKDIANQYMVTEDPFRGPGKNVKITLFKEIR 80 
285002276   1 MGYNKSLRYSRHNGTTCVIDNKHLKSLGSVLGDVRHKEELIRE-AQFDPIKDIANQYMVTEDPFRGPGKNVKITLFKEIR 79 
288804640   1 MGYNRALRYSKHEGTTCVIDNQHYKSLGAVLKDVKHKKDRLRE-AEIEPVLDIADQYMVTEDPFRGPGKNVRITLFKECR 79 
164519196   1 MGYNKSLRYSRHNGTTCVIDNKHLKSLGSVLGDVRHKEELIRE-AQFDPIKDIANQYMVTEDPFRGPGKNVKITLFKEIR 79 
14602242    1 MGYNKSLRYSRHDGTSCVIDNHHLKSLGAVLNDVRRKKDRIRE-AEYEPIIDIADQYMVTEDPFRGPGKNVRITLFKEIR 79 
9635251     1 MGYNKSLRYSRHNGTTCVIDNKHLKSLGSVLGDVRHKEELIRE-AQFDPIKDIANQYMVTEDPFRGPGKNVKITLFKEIR 79 
11068007    1 MGYNKSLRYSRHDGSTCVIDNKHLKSLGSVLGDVRRKKELIRE-SEFDPIKDIANQYMVTEDPFRGPGKNVRITLFKEIR 79 
21686666    1 MGYNKTLRYSRHDGTTCVIDNHHLKSLGSVLNDVRRKKDRIRD-AEYEPIIDIADQYMVTEDPFRGPGKNVRITLFKEIR 79 
33622204    1 MGYNKSLRYSRHDGTTCVIDNHHLKSLGAVLHDVRRKKDRIRE-AEYEPIIDIADQYMVTEDPFRGPGKNVRITLFKEIR 79 
32698540    1 MGYNKSLRYSRHEGTTCVIDNHHLKSLGSVLNDVRRKKDRIRE-AEYEPILDIADQYMVTEDPFRGPGKNVRITLFKEIR 79 
46309453    1 MGYNKSLRYSRHAGTTCVIDNKHLYSLGSVLDDIHKKDRRISE-AKYAPLKDLANQYMVTEDPFRGPGKNVRITLFKEIR 79 
109255273   1 MGYNKSLRYSRHDGTSCVIDNHHLKSLGSVLNDVRHKKDRIRE-AEYEPILDIANQYMVTEDPFRGPGKNVRITLFKEIR 79 
148368822  81 RIHPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELTLRPMQPNRCYRFTMQYALAANPDYCAHDVIRQQ 160
285002276  80 RIQPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELQLRPMQPNRCYKFTMQYALAANPDYVAHDVIRQH 159
288804640  80 RVEPDTLKLVCNWSGKEFLREMWTRFISEEFPITTDQQIMDLWFEIQCRPMQPNRCYKFTMQYALGAHPDYVPHDVIRAQ 159
164519196  80 RIQPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELQLRPMQPNRCYKFTMQYALAANPDYVAHDVIRQH 159
14602242   80 RVHPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELQLRPMHPNRCYKFTMQYALGAHPDYVAHDVIRQQ 159
9635251    80 RIQPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELQLRPMQPNRCYKFTMQYALAANPDYVAHDVIRQH 159
11068007   80 RVQPDTLKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELQLRPMQPNRCYKFLMQYALGADADYVPHDVIRAQ 159
21686666   80 RVHPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELQVRPMHPNRCYKFTMQYALGAHPDYVAHDVIRQQ 159
33622204   80 RVHPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIIDLWFELQLRPMHPNRCYKFTMQYALCAHPDYVAHDVIRQQ 159
32698540   80 RVHPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFEIQLRPMHPNRCYKFTMQYALGAHPDYVAHDVIRQH 159
46309453   80 RVQPDTMKLICNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFELQLRPMQPNRCYRFTMQYALGAHPDYVAHDVIRQQ 159
109255273  80 RVQPDTMKLVCNWSGKEFLRETWTRFISEEFPITTDQEIMDLWFEIQLRPMQPNRCYKFTMQYALGANPEYVAHDVIRQQ 159
148368822 161 DPYYVGPDNRERINLSKKGEAFPLTCLQSIYNENFEEFFDSVLWPYFHRPLVYVGTTSAEIEEVMIEVALLFKIKEFAPD 240
285002276 160 DPYYVGPDNRERINLSKRGLAFPLTCLQSIYNENFEEFFDQVLWPYFHRPLVYVGTTSAEIEEVMIEVALLFKIKEFAPD 239
288804640 160 DPYYIGPNNIERINL-KKGFAFPLMCLQSVYNDNFETFFEDVLWPYFHRPLVYIGTTSSETEEILLEVSFLFKIKEFAPD 238
164519196 160 DPYYVGPDNRERINLSKRGLAFPLTCLQSIYNENFEEFFDQVLWPYFHRPLVYVGTTSAEIEEVMIEVALLFKIKEFAPD 239
14602242  160 DPYYVGPNNIERINLSKKGFAFPLTCLQSVYNDNFERFFDDVLWPYFYRPLVYVGTTSAEIEEIMIEVSLLFKIKEFAPD 239
9635251   160 DPYYVGPDNRERINLSKRGLAFPLTCLQSIYNENFEEFFDQVLWPYFHRPLVYVGTTSAEIEEVMIEVALLFKIKEFAPD 239
11068007  160 DPYYVGPHNVERISLSRQGVAFPLTCLQAVYNESFETFFEDNLWPYFHRPLVYVGTTSGEVEEIMIEVALIFKIKEFAPD 239
21686666  160 DPYYIGPNNVERICLSKQGVAFPLTCLQSVYNDNFETFFDDVLWPYFYRPLVYVGTTSSEIEEIMIEVSLLFKIKEFAPD 239
33622204  160 DPYYVGPNNIERINLSKKGFAFPLTCLQSVYNDNFENFFDDVLWPYFHRPLVYVGTTSAEIEEIMIEVSLLFKIKEFAPD 239
32698540  160 DPYYVGPNNIERINLSKKGFAFPLTCLQSVYNDNFERFFDDVLWPYFHRPLVYIGTTSAEVEEIMIEVSLLFKIKEFAPD 239
46309453  160 DPYYVGPNNIERINLSKKGYAYPLTCLQSVYNDNFENFFDEHLWPYFHRPLVYVGTTSAEIEEIMIEVSLLFKIKEFAPD 239
109255273 160 DPYYVGPNNMERINLSKKGFAFPLTCLQSVYNDNFERFFDDILWPYFHRPLVYVGTTSAEIEEIMIEVSLLFKIKEFAPD 239
148368822 241 VPLFTGPAY 249
285002276 240 VPLFTGPAY 248
288804640 239 VPLYTGPAY 247
164519196 240 VPLFTGPAY 248
14602242  240 VPLFTGPAY 248
9635251   240 VPLFTGPAY 248
11068007  240 VPLFTGPAY 248
21686666  240 VPLFTGPAY 248
33622204  240 VPLFTGPAY 248
32698540  240 VPLFTGPAY 248
46309453  240 VPLFTGPAY 248
109255273 240 VPLFTGPAY 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap