Conserved Protein Domain Family
gp37

?
PHA03387: gp37 
spherodin-like protein; Provisional
Statistics
?
PSSM-Id: 177623
View PSSM: PHA03387
Aligned: 39 rows
Threshold Bit Score: 382.433
Threshold Setting Gi: 14602254
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195457   1 MTSLYFVVYc-SLILIDQACAHGYMSWPAARQYKCYRDNNFWWPDTGENIPDEACREAYQSVYAKYRSQGESPGVAANAA 79 
228861610   4 IKCYYFATIlvVVSLTNPVNCHGYLSWPAARQFKCYRDGKFWWPDNGDAIPDDACRSAYKTVYTKYINSGESHGAAANAA 83 
114679882  10 RFVSVACVF----ASLQQVASHGYLSYPVARQYRCYVDGEFWWPSNGDGIPDEACRDSYKSVYYKYRSNGSSEGEAANAA 85 
118197530   1 ---MYFIILalNVVLLHTINGHGYLSWPAARQYKCYRDNNFWWPETGENIPDDACREAYQTVYAKYRNAGESHGLAANAA 77 
15617504   99 DVVKFLSLL----AFVATVSCHGYLSYPPARQQLCYADGNFWWPLDGDAIPDRACRDAYRSVYYKYRSNGSSEGEAANAA 174
9631035     2 FIWATICAV--AAALATTADAHGYLSRPAARQFKCFRDGRFWWPETGEDIPDEACRRAYRTVYAKYRSAGESGGVAANAA 79 
9635357     1 ---MIYNIFllLLVFTTTVKSHGFMLYPLARQYRCYAPQDFYWPDDGSNIQNPACKLAFQHVYRN---------SGSAAA 68 
14602254    5 MKNPIIVLYilCTTVSVNVLGHGYMVYPLARQRHCYNGQDYYWPVDGAGIKDEGCRAAFQHVYTR-------NGNNSAAA 77 
164519304   1 ---MIYNIFllLLVFATTVKSHGFMLYPLARQYRCYAAQDFYWPDDGSNIQNPACKLAFQHVYRN---------SGSAAA 68 
285002385   1 -MMIYNIIFilLAVSTTTVKSHGFMLYPLARQYRCYAAQDFYWPDDGSNIKNPACRLAFQHVYQK---------SGAAAA 70 
113195457  80 QYMFQQYYEYAAVAGQQYDDIDHIKNTVVSS-HLCAAGAAERWGVFGDKSGMDLPL-SNWRPDRLYkmssngdNNKYNDS 157
228861610  84 QYMFQQYYEYAALAGPNHQDFEYVKKHVIPD-SLCAAGARNRSHVFGDKSGVDEPFgGAWRAQTLH-------LLKYNEG 155
114679882  86 QYMFQQYQEYAALAGSNYEDVDHLRNEVVRSgRMCSADATNRSMAFGDKSGMDLPT-SRWRTTTIG-------------S 151
118197530  78 QYMFQQYYEYAATAGPNYDDFEHIKNSVVVD-SLCAAGANMRTQTFGDKSGIDIPL-PNWRPDVLYh------QNIPVND 149
15617504  175 QYMFQQRQEYAAIAGPDY--LYNVRDVVVSG-SLCSAGATDRKRVFGDKSGMDLAS-PHWRRTTLP-------------S 237
9631035    80 QYMFQQYFEYAALAGADYQNLEHVQENVVAA-DLCAAGASDRSRPFGDKSGIDEPF-DDWRADTLYp-----rADESASS 152
9635357    69 QYMFVQYAEYAALAGSNYNDMQHIQQDVVPN-FLCSAAADNTSTPYGDKSGISLPS-DHWQTTIIN------------DR 134
14602254   78 QAMFNQNAEYAAMAGKDYRNLTHIRESVVPK-YLCGAGAANASARFGDKSGMDTVN-VTWRTNTVP------------YK 143
164519304  69 EYMFVQYAEYAALAGSNYNDMKHIERDVVPD-LLCSAAADNTSTPYGDKSGISLPS-HHWQTTIIN------------DY 134
285002385  71 QYMFVQYAEYAALAGSNYNDMEHIQHDVVPK-LLCSAAADNASTPYGDKSGISLPS-HHWQTTTLI------------KR 136
113195457 158 IITNIHFCPTTVHEPSYFEVFMSKPSYNY-SSMLTWDDL-QPVEileldndvyhyNKHSNLVANEGv--DEFCTNTMIYV 233
228861610 156 VNVILNFCPTTEHDPSYFQVFITKPEYDY-SHKLDWDDL-EALD-----------SDGFVLSENDGf--DEACAADRLYK 220
114679882 152 PHQTIRFCATTVHEPSYFEVYVTDELFDVaHDKVAWDNV-QNVP-----------IESADLVDMSSr-rDPYCDESHAYE 218
118197530 150 LPIEISLCPTTVHEPSYFQVFVTKPDFEY-DHELVWDDLeELVL-----------TGESRLVDNTGt--DESCTNSQIYK 215
15617504  238 NRITIRFCPTVVHEPSYFEVYITKNSYDAdGGPLTWNDL-EIVDs----------VEPHELIENND---LEDCDESLVYV 303
9631035   153 RAVALHFCPTTVHEPSFFQIFISREAYNY-TRKLTWRDL-ELVEn----------ETPARLIANDGt--DENCASPSVYA 218
9635357   135 GHTQLYYCPTVPHDPSFFQVFVTKKDFDVgTTIVTWNDL-ELVH-----------EQSAVIVPNSRtvpNSEECGAFVYS 202
14602254  144 ERDTFYFCPTAVHEPGYFEVYVSREGYDAgKSSLQWSDL-ELVY-----------SNTSNLVTKK----LDLCSSDRMYE 207
164519304 135 GHTQLYYCPTVPHDPSFFQVFVTKNDFDVgTSEITWNDL-ELLQ-----------EQSAVIVPNSRavpNSEECGAFVYS 202
285002385 137 GLTQLYYCPTVPHDPSFFQVFITKNDFDVgGTEITWNDL-ELLQ-----------EQSSVIIPNSKnvpNNEECGAFVYS 204
113195457 234 I-RVRIPHRHDKFVLYVRWQRIDPVGEGFYNCADVIFDDHYWPESEKKNIHDEF 286
228861610 221 I-PVVIPFRSRKFMLFVRWQRDDVAGEGFYNCADLIYNDAQNLIYDDYLQNSNE 273
114679882 219 I-RVQLPLRMNPFVLFVRWQRIDVAGEGFYNCADVQYASTKDSSLSSSTTNERF 271
118197530 216 I-PVRVPWRTQKFILFVRWQRRDIAGEGFYNCADVVFDKFALKHRYKTKTSSSS 268
15617504  304 L-DAILPMRFDPFVLFVRWQRIDVVGEGFYNCADVQYSENILSYCTCNV----- 351
9631035   219 L-EARVPLRPGKFVLYVRWQRRDVAGEGFYNCADVTFDANSLGTLVRNRDEL-- 269
9635357   203 I-DATLPMRSKPFVVFVRWQREDPVGEGFYDCSDVVYRTKNEL----------- 244
14602254  208 LrDVKIPLRSGGFVMYVRWQREDVGGEGFYNCVDVVHKQTKSDL---------- 251
164519304 203 I-DATLPMRSKPFVVFVRWQREDPVGEGFYDCSDVVYRTKNEL----------- 244
285002385 205 I-NVSLPLRHKPFTVFVRWQREDSVGEGFYDCSDVVYNGHTKFEL--------- 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap