Conserved Protein Domain Family
IX

?
PHA03385: IX 
capsid protein IX,hexon associated protein IX; Provisional
Statistics
?
PSSM-Id: 177621
View PSSM: PHA03385
Aligned: 10 rows
Threshold Bit Score: 124.963
Threshold Setting Gi: 253761979
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51527268    1 MSGNGSFEGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPANSSTLTYATLS-SSSVDAAAAAAAASAASAvrGMAMG 79 
253761979   2 NGTGGAFEGGLFSPYLTTRLPGWAGVRQNVMGSTVDGRPVLPANSSTMTYATVGtSSSLDSTAAAAAAAAAMT--ATRLA 79 
61602087    6 DGNA--FEGGVFSPYLTSRLPSWAGVRQNVVGSTVDGRPVAPANSATLTYATVG--SSLDTAAAAAASAAASTarGMAAD 81 
51518819    6 SQTALSFDGAVYSPFLTGRLPAWAGVRQNVTGSTVDGRPVDPSNAASMRYATIS-TSTLDSAAAAAAATSAAL--SAAKI 82 
9626565     6 EGNAVSFEGGVFSPYLTTRLPSWAGVRQNVVGSNVDGRPVAPANSTTLTYATIG--SSVDTAAAAAASAAASTarGMAAD 83 
9626625     6 QNNAALFDGGVFSPYLTSRLPYWAGVRQNVVGSTVDGRPVAPANSSTLTYATIG-PSPLDTAAAAAASAAASTarSMAAD 84 
9626166     1 -MSANSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANSTTLTYETVS-GTPLETAASAAASAAAATarGIVTD 78 
190340978   2 NGTGGAFEGGLFSPYLTTRLPGWAGVRQNVMGSTVDGRPVLPANSSTMTYATVG-SSSLDSTAAAAAAAAAMT--ATRLA 78 
197944730   1 MSGSASFEGGVFSPYLTGRLPPWAGVRQNVMGSTVDGRPVQPANSSTLTYATLS-SSPLDAAAAAAATAAA----NTILG 75 
197944770   1 MSGNASFKGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPANSSTLTYATLS-SSPLDAAAAAAAASVAA---NTVLG 76 
51527268   80 AGYYGTlvANSSSTNNPASLNEEKLLLLMAQLEALTQRLGELTQQVAQLQEQTRAAVA 137
253761979  80 SSYMPS--SGSSPSIPSSIIAEEKLLALLAELEALSRQLTALTQEVSELREQQQQQNK 135
61602087   82 FGLYNQ--LATAAVASRSLVQEDALNVILTRLEIMSRRLDELAAQISQANPDTASES- 136
51518819   83 MAINPSlySPVSVDTSALDLYRRDLAQVVEQLAAVSQQLQLVSTRVEQLSRPPQ---- 136
9626565    84 FGLYNQ-------LAASRLREEDALSVVLTRLEELSQQLQDMSAKMALLNPPANTS-- 132
9626625    85 FSFYNH---LASNAVTRTAVREDILTVMLAKLETLTAQLEELSQKVEELADATTHTPA 139
9626166    79 FAFLSP---LASSAASRSSARDDKLTALLAQLDSLTRELNVVSQQLLDLRQQVSALKA 133
190340978  79 SSYMPS--SGSSPSVPSSIIAEEKLLALLAELEALSRQLAALTQQVSELREQQQQQNK 134
197944730  76 MGYYGSivANSSSSNNPSTLAEDKLLVLLAQLEALTQRLGELSKQVAQLREQTESAVA 133
197944770  77 MGYYGSimANSTSSNNPSTLTQDKLLVLLAQLEALTQRLGELSQQVVELRVQTESAVG 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap