Conserved Protein Domain Family
PHA03383

?
PHA03383: PHA03383 
PCNA-like protein; Provisional
Statistics
?
PSSM-Id: 177619
View PSSM: PHA03383
Aligned: 7 rows
Threshold Bit Score: 370.769
Threshold Setting Gi: 290343579
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631761     1 MDDDNVLFHIRTLQGNVIKSLFDCLKEILHDVMLSFGPTGIRISALDGAKVSLVHLKLDSESFEEYKCEHTYEL-GVNVL 79 
155370117   3 STESKPLFHIRTVQGSVIKSLFDTLKEILHDVSITFDPTGVKISAMDGSKVSLVHMKLNAESFEEYDCPKSYEI-GINVA 81 
155371735  30 MSSDDVLFCIRTVQGSVIKSLFDTLKEILHDVSITFSPSGVKISAMDGAKVSLVHMKLDAEAFEEYVCNNTYEI-GVNVT 108
163955088   1 -------MRLVTIQASAIKSTFEVLKDILNDVNIFFRPQGMYIVTLDTARTSLIDMFLSADNFEEYHCDQEEIIaGINIS 73 
157953431   1 MEDENVLFHIRTLQGNVIKSLFDCLKEILHDVMLSFGPTGVRISALDGAKVSLVHLKLDSESFEEYKCEHTYEL-GVNVL 79 
157952565   1 MEDDNVLFHIRTLQGNVIKSLFDCLKEILHDVMLSFGPTGIRISALDGAKVSLVHLKLDSDSFEEYMCEHTYEL-GVNVL 79 
290343579   1 -------MRLVTIQASAIKSTFEVLKDILNDVNIFFRPQGMYIVTLDTARTSLIDMFLSADNFEEYHCDQEEIIaGINIS 73 
9631761    80 NMFKLLRSAGSHDSILFRYLKNDPHMIELTIQNFEKNSLTKFNMKLIEIDSVEIEVGDIEFDTIIVMPANYFQRICRDMS 159
155370117  82 NMFKLLRSAGSHDSILFRYMEENPHVLEITIQNFEKNSLTKFEMKLIEIDSAYIEISDLEFDTIISIPSNYFQRLCRDMS 161
155371735 109 NLFKLLRTTGSRDSIMFRYLKSNPHVLEITIQNFEKNSTTQFFLKLIEIDSACIDINDLEFDAIISIPSNYFQRLCRDMS 188
163955088  74 NTFKLLKTITNNDVLTMEI--NSKEFMDIEIISESKKTSTKFQLKLLDINESRIEVPDVTMTSVTILPSADFQRLCRDMS 151
157953431  80 NMFKLLRSAGSHDSILFRYLKNDPHMLELTIQNFEKNSLTKFNMKLIEIDSVEIEVGDIEFDTIIVMPANYFQRICRDMS 159
157952565  80 NMFKLLRSAGSHDSILFRYLKNDPHMLELTIQNFEKNSLTKFNMKLIEIDSVEIEVGDIEFDTIIVMPANYFQRICRDMS 159
290343579  74 NTFKLLKTITNNDVLTMEI--NSKEFMDIEIISESKKTSTKFQLKLLDINESRIEIPDVTMTSVTILPSADFQRLCRDMS 151
9631761   160 DITDHLVIVKKGDEVSFNSDYTCVTDFASQKTIIGDSDNGQITCNNDTDYESKFSLKYLTSFCKASGMSSAVEIYLKESY 239
155370117 162 ELTDFLWIEKKSGVVSFCSDYLSATDFASQRTVLGDSETGKITTMEEADYSNKFSLKYLIGFAKASGLSPVVELYLKSGF 241
155371735 189 ELTNFLWIEKKDGQVSFCSDYTSVTDFASQRTILGDSDMGKIITVEEASYSNKFSLKYLTSFSKASGLSSVVEMFIKTSL 268
163955088 152 NIGQDIEITRSGKELRLR----CEGDFANQETFIECPE-------ESPEMTGLYSLRYLNIFTKATSMCASVQIMQEEGN 220
157953431 160 DITEHLVIVKKGDEVSFNSDYTCVTDFASQKTIIGDSDNGQITCNNDTDYESKFSLKYLTSFCKASGMSSAVEIYLKESY 239
157952565 160 DITDHLVIVKRGDEVSFNSDYTCVTDFASQKTIIGDSDNGQITCNNDTDYESKFSLKYLTSFCKASGMSSAVEIYLKESY 239
290343579 152 NIGQDIEITRSGKELRLR----CEGDFANQETFIECPE-------ESPEMTGLYSLRYLNIFTKATSMCASVQIMQEEGN 220
9631761   240 P-LILKYTVGSMGALKFVIAPILS 262
155370117 242 P-LVLRYSIGSIGNLKFVIAPAFQ 264
155371735 269 P-LVLKYSIGSIGSLKFVIAPSME 291
163955088 221 RfLILKYNVANLGELKFYLATKVS 244
157953431 240 P-LILKYTVGSMGNLKFVIAPVLS 262
157952565 240 P-LILKYTVGSMGNLKFVIAPVLS 262
290343579 221 RfLILKYNVANLGELKFYLATKVS 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap