Conserved Protein Domain Family
PHA03381

?
PHA03381: PHA03381 
tegument protein VP22; Provisional
Statistics
?
PSSM-Id: 177618
View PSSM: PHA03381
Aligned: 5 rows
Threshold Bit Score: 280.744
Threshold Setting Gi: 9629319
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629430    1 MTSRRSvksgPREVPRDEYE---DLYYTPSSGMASP-----DSPPDTSRRGALQTRSRQRGEVRFVQYDE---SDYALYG 69 
83722618   1 MASRRF----PKPKPHGTDEieaDVYYDFIAPDPSParvsfEEPAGRARAPRAPARGRSQAARHDHPHEPa-rADYPYAT 75 
9629319    1 MTSRRSvkscPREAPRGTHE---ELYYGPVSPADP------ESPRDDFRRGAGPMRARPRGEVRFLHYDE---AGYALYR 68 
56694772   1 MASRRF----PRPKPHGTDEveaDVYYDFIAPDPSParvsfEEPAGR-------ARGRSQAARHDRPRETa-rADYPYAT 68 
30984477   1 MASRRL----PKPKPHGTDEveaDVYYDFITPDASParvsfEEPGARARAPRSQARGRSQAGRYGHHYQDtarVEYPYPA 76 
9629430   70 GSSSEDDEHPEVPRTRRPVSGAVLSgpgPARAPPPPAGSGGAGR-TPTTAPRAPRTQRVATkapaapaaeTTRGRKSAQP 148
83722618  76 GSSSEDERPADPRPSRRPHAQPEAS---ASRGARGVAPSRARARvAESPSPRDAPNPKGAS---------APRARKSACA 143
9629319   69 DSSSDDDESRDTARPRRSASVAGSHgpgPARAPPPPGGPVGAGGrSHAPPARTPKMTRGAPkasatpatdPARGRRPAQA 148
56694772  69 GSSSEDERPADPRPSRRPHAQPEAP---SSRGARGAATSRARARaAESPSPRDPPNPKGAS---------APRTRKSACA 136
30984477  77 GSSSEDERPADPRPSRRAHAQPEAPgqsAPRGARGAAAARGRVR-AESPSPRRDPDPKGAS---------VPRARKSACA 146
9629430  149 ESAAlpDAPASTAPTRSKTPAqGLARKLHFSTAPPNPDAPWTPRVAGFNKRVFCAAVGRLAAMHARMAAVQLWDMSRPRT 228
83722618 144 AAAA--SASAPAAPKDQAAPA-AVPRKLHFSTAPTSPTAPWTPRVAGFNKRTFCAAVGRVAATHARRAAAQLWDLSHPRN 220
9629319  149 DSAVllDAPAPTASGRTKTPAqGLAKKLHFSTAPPSPTAPWTPRVAGFNKRVFCAAVGRLAATHARLAAVQLWDMSRPHT 228
56694772 137 ---A--DALAPAAPKGQATPA-VVPRKLHFSTAPTSPTAPWTPRVAGFNKRTFCAAVGRVAATHARMAAAQLWDLSHPRN 210
30984477 147 TATAtaTTTAAAAGAAKSQTA-AAAKKLHFSTAPTSPTAPWTPRVAGFNKRTFCAAVGRVAATHARMAAAQLWDLSHPRN 225
9629430  229 DEDLNELLGITTIRVTVCEGKNLLQRANELVNPDVVQDVDAATATrgrsaasRPTERPRAPARSASRpRRPVE 301
83722618 221 DEELNDLLGATNIRIIVCEGLNLVPRANELISPEVAQEADADVRG-------RATARSRAGARSASR-RRPPE 285
9629319  229 DEDLNELLDLTTIRVTVCEGKNLLQRANELVNPDAAQDVDATAAArgr-pagRAAATARAPARSASRpRRPLE 300
56694772 211 DEELNDLLGATNIRIIVCEGLNLVPRANELISPEVAQEVDVAVRG-------RTGARDRTGARSASR-RRPPE 275
30984477 226 DEELNDLLGATNIRIIVCEGLNLVPRANELISPEVAQDADVGVRG-------RATT-ARPAGRSASR-RRPPE 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap