Conserved Protein Domain Family
PHA03377

?
PHA03377: PHA03377 
EBNA-3C; Provisional
Statistics
?
PSSM-Id: 177614
View PSSM: PHA03377
Aligned: 3 rows
Threshold Bit Score: 1266.9
Threshold Setting Gi: 51518090
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
139424500    1 MESFEGEGDSIQSPDNARGDDVQNTGEHIQDPGPGPSTGGASEGLVQNEPDSRDQQSRGQRRGDENRGWMQRIRRRRRRR 80  
82503227     1 MESFEGQGDSRQSPDNERGDNVQTTGEHDQDPGPGPPSSGASERLVPEESYSRDQQPWGQSRGDENRGWMQRIRRRRRRR 80  
51518090     1 -MASQGEGDDIHSTQEEPGDNVQRTGELV--PGTGSQAGEPPMGTTQRDECTAETGQ--QAGGGEQETWMQHVRQRRRRR 75  
139424500   81 AALSGHLLDMEDNVPPWFPPHDITPYVARNIRDAACQAVKHSHLQALSNLILDSGLDTQHLLCFVMAARQRLQDIRRGPL 160 
82503227    81 AALSGHLLDTEDNVPPWLPPHDITPYTARNIRDAACRAVKQSHLQALSNLILDSGLDTQHILCFVMAARQRLQDIRRGPL 160 
51518090    76 HERAGEYLGGAGVELPWLPPFVTRPYSAVELRNAAYEAVVQPSTHVLANLMFDRNVDPRQMVCFMMAARQRCRDLERGPS 155 
139424500  161 VVEGGVGWRHWLLTSPSRSWSMGYRTATLRTLTPVPNRVGADSIMLTATFGCQNGALAINTFSATVWIPPPAGPREQERY 240 
82503227   161 VAEGGVGWRHWLLTSPSQSWPMGYRTATLRTLTPVPNRVGADSIMLTATFGCQNAARTLNTFSATVWTPPHAGPREQERY 240 
51518090   156 TAP---GWRHWVLTSPSVTWYMGFRTASIRTRTSAPDMIGADNVKVMVMMGCHTGARNERAFSAQVWTPYLPGAREQERF 232 
139424500  241 AREAEVRFLRGKWQRRFRRIFD-LIELCGSLHHVWQNMLQTEENLLDFVRFMGVMSSCNSSSVNYWFHKTIGNFKPYYPW 319 
82503227   241 AREAEVRFLRGKWQRRYRRIYD-LIELCGSLHHIWQNLLQTEENLLDFVRFMGVMSSCNNPAVNYWFHKTIGNFKPYYPW 319 
51518090   233 SREAEAFSQRRRWQRRYRVIFDpYSESYYSLRHIWLHRLQSDAQLFDFARFMGAMTRCGNPALKYWWHKSIGTYKPSVPW 312 
139424500  320 NAPPNENPYHARRGIKEQVIQKAFLKAQRQGLSMLATGGGPRGDATSETSSDEDTGRQGSDVELESSDDELPYIDPNMEP 399 
82503227   320 NAPPNENPYHARRGIKEHVIQNAFRKAQIQGLSMLATGGEPRGDATSETSSDEDTGRQGSDVELESSDDELPYIDPNMEP 399 
51518090   313 YPRPNEQAFHTCRGLNSDDLKTTFREAQRLGLRLLER-EEPDIDDIVETSSEEEGGRD-SDSQMESSDDELPYTAPGMEI 390 
139424500  400 VQQRPVMFVSRVPVRKPRTLPWPTPKTHPVKRTIVKTSYRSDEAEeAQSTPERPGPSKQPSEPVEPAHTTPAGRSTVILH 479 
82503227   400 VQQRPVMFVSRVPAKKPRKLPWPTPKTHPVKRTNVKTSDRSDKAE-AQSTPERPGPSEQSSVTVEPAHPTPVEMPMVILH 478 
51518090   391 PQRRPLIFIYGLPW---RTRPWPTCITHPAVPSLGVDEGSSDEMEqDSSLPAQPGPSDNPPVPTTPPILTQVEHTTAIVH 467 
139424500  480 EPPREPEAVSFKPPPPPSRRRRGACVVYD-DDIIEVIDVETTEEETtsmqrqpplgqqppppvistgsamssshtdpSVT 558 
82503227   479 QPPPVPKPVPVKPTPPPSRRRRGACVVYD-DDVIEVIDVETTEDSS-------------------------------SVS 526 
51518090   468 QPPQSPPTEAIEDAPQSVGVPSGACVVTTaHDIIEVIDVESSDEEE---------------------------------- 513 
139424500  559 QPSKPHRKPQDGFQRSGRRQKRAMPPPVSPSDAGPPSTRPRVMAPPSTGPRVMATPSTGPRDMAPPSTGPRDMA-----P 633 
82503227   527 QPNKPHRKHQDGFQRSGRRQKRAAPPTVSPSDTGPPAVGPPAAGPPAAGPPAAGPPAAGPPAAGPPAAGPRILAplsagP 606 
51518090   514 APARKRRAVVSTGEVSG------TLPKVKPSKRGRPKASQP----------------------------EKQQQkckdgA 559 
139424500  634 PSTGPRDMAPPSTGPRDMAPTVVHMFTRERLLTQSTGPAPRSFWEMRAGRDAPKIQQEPSSQQQPATQSTPPCQSWVPSV 713 
82503227   607 PAAGPHIVTPPSARPRIMAPPVVRMFMRERQLPQSTGRKPQCFWEMRAGREITQMQQEPSSHLQSATQPTTPRPSWAPSV 686 
51518090   560 PASTQHEKQPKSSAP----PSKFRELLRERLMERPFGPKPKSFWEMRASRDGSG-KQPPASRRGPTLQ----RPTRLPSV 630 
139424500  714 YVLPAVDAGNAQPLQISHLSSMSPTQPISHEEQPRYED-------------------------------PDTPLDLSLHP 762 
82503227   687 CALSVMDAGKAQPIESSHLSSMSPTQPISHEEQPRYED-------------------------------PDAPLDLSLHP 735 
51518090   631 FVLPSVPTTRPRASEESRKHPLSAKRPTLHSEQLTYEDsspsrhacsayddiefdvqyseddeepkpqePQDTTDVESQP 710 
139424500  763 DTATLP--------PTQDLYPGRED--LQATQAPYPGYEEPRP------------------------------------- 795 
82503227   736 DVAAQP--------APQAPYQGYQE--PPAPQAPYQGYQEPPP------------------------------------- 768 
51518090   711 LQDPPPgfreaqyqSHRAPFSGHEEpwPQHQQAPYPGYWEPRPqtqhprqapcqtygepqpqpqhsqqaplptygepqpq 790 
139424500  796 ----------------------PQAPFVGdygfVQIPSAQwephpsqgtyqghidpqlpa-------------------- 833 
82503227   769 ----------------------PQAPYQG----YQEPPAH---------------------------------------- 782 
51518090   791 pqepqcptyqgyvelqpqqpqaPPIPYLG----YREPQAQpqhaqqaprpvahgesqpqpqeplhppyldyrepqpqqsq 866 
139424500  834 --------------------------------------------------------aldlgpeqprfpqdpyvysGGQLS 857 
82503227   783 ---------------------------------------------------------------------------GLQSS 787 
51518090   867 dplapypnygkpqtqhpkampipylgyresqpqqpqpppapypgygaprmqpsraphpgyreiqpqaplapymhpRVSVA 946 
139424500  858 SCPGYAGPWPSRPQHPRYRHTLALWPREPRHGHSQGPWKPWSAHLP-----PQWDGSAGHGQDQVSQFPHLHSETGPPRL 932 
82503227   788 SYPGYAGPWTPRSQHPCYRHPWAPWSQDPVHGHTQGPWDPRAPHLP-----PQWDGSAGHGQDQVSQFPHLQSETGPPRL 862 
51518090   947 QYPGDSGPWGLRAQYQRYRHSWAYWSQYPGYGPPLTPWAQRPPYPSypcsqPTWAPYPRPAHTH-----PLQPQPVPPTP 1021
139424500  933 QLSSVPqvlypqpLVSSSAPSWSSPQPRAPIRPIPTRFPPPPMPLQDSMAVGCDSSGTACPSMPFASDYSQGAFTPLDIN 1012
82503227   863 QLSLVP-------LVSSSAPSWSSPQPRAPIRPIPTRFPPPPMPLQDSMAVGCDSSGTACPSMPFASDYSQGAFTPLDIN 935 
51518090  1022 EQTQAQqlpysqtPDSAAALPLLSTPREAPLRPIPTRLPTPSTPLQDSMTTGATAPGTSHPNVIFASNLSQGAFTQVGTE 1101
139424500 1013 APTPKSPRVEESS-HGPARCSQATSEAQEILSDNSEISVFPKDAKQTDYDASTESELD 1069
82503227   936 ATTPKRPRVEESS-HGPARCSQATAEAQEILSDNSEISVFPKDAKQTDYDASTESELD 992 
51518090  1102 GQHQKRPRLEGSHfHTNLDKAAGETQAAEVISEGSDVSKGQKDTQHTDYDASTESDIE 1159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap