Conserved Protein Domain Family
PHA03376

?
PHA03376: PHA03376 
BARF1; Provisional
Statistics
?
PSSM-Id: 177613
View PSSM: PHA03376
Aligned: 3 rows
Threshold Bit Score: 352.474
Threshold Setting Gi: 139424546
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
139424546   1 MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDI 80 
51518086    1 MARLFAQLLLLAGSVASCLAVTAFVGERAVLSSYWKRVSLGPEIMVEWFKLGPGEEQTLIGRMHQDVILIEGPFRGFFDM 80 
82503275    1 MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDI 80 
139424546  81 HRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLM 160
51518086   81 YRSANTFFLILTTANISHDGSYLCRMRLGETEVTKQELLSVVKPLTLSVQAKRSVFPDFSTLNVRCKVNAYPRPYVQWLM 160
82503275   81 HRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLM 160
139424546 161 PEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLS 220
51518086  161 PEGADPAPTVTQGEAMKEGDGSLSVVVYLHLHKPWQLPVTCVGKNEKEEVQGVYVSGYVL 220
82503275  161 PEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLS 220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap