Conserved Protein Domain Family
PHA03372

?
PHA03372: PHA03372 
DNA packaging terminase subunit 1; Provisional
Statistics
?
PSSM-Id: 177609
View PSSM: PHA03372
Aligned: 7 rows
Threshold Bit Score: 1206.17
Threshold Setting Gi: 51874288
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52139262    1 MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVAALCRKRYQMMHPELGLAHSCNEAFLPLMAFCGRHRDYNSpEEsQ 80 
213159228   1 MLSDVAQQSLRSEYIELRRTKKRRTGVISSEFPSVGTLCKKRFQTVHPELGVIHACNESILPLMQFCTKYRDYNS-ECiT 79 
51874288    1 MLRSCDIDAIQKAYQSIIWKHEQDVK-ISSTFPNSAIFCQKRFIILTPELGFTHAYCRHVKPLYLFCDRQRHVKS----- 74 
9633135     1 MLRTCDITHIKNNYEAIIWKGERNCSTISTKYPNSAIFYKKRFIMLTPELGFAHSYNQQVKPLYTFCEKQRHLKN----R 76 
14251081    1 MLSHETVHALRARYDELKRHREARPNVISTEFPDAATLCKKRFQTLSPELGLAHACNSVCLPLVRFCRAYRDYNQpLTrH 80 
20026680    1 MLHGDSAAKIQERYEELQKRKNHPTSCISTAFTNVAALCRKRYQMMHPELGLAHSCNEAFLPLMAFCGRYRDYHSpEE-K 79 
224020406   1 MLRTCDITHIKNNYEAIIWKGERDCSTISTKYPNSAIFYKKRFIMLTPELGFAHSYNQQVKPLYTFCEKQRHLKN----R 76 
52139262   81 RELLFHERLKSALDELTFRPCSEE--QRASYQKLDALTELYRDPQFQQINNFMTDFKKWLDGGFSTAVEGd--AKAIRLE 156
213159228  80 QKLFLSDALESALGRIRLEEALVR--DRSAQDKAAALTGLYQEPEFVQISNFIADFRRWTEGGYDGDRQI---NRRVYLE 154
51874288   75 -KIAICDPLNCALSKLKFTAIIEKntEVQYQKHLELQTSFYRNPMFLQIEKFIQDFQRWICGDFENTNK----KERIKLE 149
9633135    77 KPLTILPSLTRKLQEMKFLPASDKsfESQYTEFLESFKILYREPLFLQIDGFIKDFRKWIKGEFNDFGD----TRKIQLE 152
14251081   81 ATLNLSAAVRAGLDEITFRPCSEE--QRSQSHKIAALTGLYKDPDFLQINSFLTDFRRWIDGDFDPSGGGdksTTHIYLE 158
20026680   80 RELVFHERLKSALDELAFRPCPEE--QRASYQKLDALTELYRDPQFVQINSFMTDFKKWLDGGFATAEGD---AKPIRLE 154
224020406  77 KPLTILPSLSHKLQEMKFLPASDKsfESQYTEFLESFKILYREPLFLQIDGFIKDFRKWIKGEFNDFGD----TRKIQLE 152
52139262  157 PFQKNLLIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSIDIFKQKATVFLVPRRHGKTWFIIPIISFLLKHMIGI 236
213159228 155 PFQKNLLIHVIFFVAVTKMPVLANRVLEYLLHVFDIEFISRNSVNLFKQKATVFLVPRRHGKTWFMIPIICFLLKNIIGI 234
51874288  150 PFQKSILIHIIFFISVTKLPTLANHVLDYLKYKFDIEFINESSVNILKQKASVFLVPRRHGKTWFMIPVICFLLKNLEGI 229
9633135   153 PFQKNILIHVIFFIAVTKLPALANRVINYLTHVFDIEFVNESTLNTLKQKTNVFLVPRRHGKTWFIVPIISFLLKNIEGI 232
14251081  159 PFQKNLLMHVLVFIAVTKLPVLANRVAEYLLYMFDIDFLSAASLDLFKQKATVFLVPRRHGKTWFTVPIICFLLKNVQGI 238
20026680  155 PFQKNLLIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSIEIFKQKATVFLVPRRHGKTWFIIPIISFLLKHMIGI 234
224020406 153 PFQKNILIHVIFFIAVTKLPALANRVINYLTHVFDIEFVNESTLNTLKQKTNVFLVPRRHGKTWFIVPIISFLLKNIEGI 232
52139262  237 SIGYVAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVISIDHRGAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKK 316
213159228 235 SIGYVAHQKHVSQFVLKEVEFRCRRMFSSTHTIENKDNVISIDHHVAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKK 314
51874288  230 SIGYVAHQKHVSHFVMKDVEFKCRRFFPQK-NITCQDNVITIEHETIKSTALFASCYNTHSIRGQSFNLLIVDESHFIKK 308
9633135   233 SIGYVAHQKHVSHFVMKEVEFKCRRMFPEK-TITCLDNVITIDHQNIKSTALFASCYNTHSIRGQSFNLLIVDESHFIKK 311
14251081  239 SIGYVAHQKHVSQFVLKEVEFRCRRLFGRTHTVENKDNVISIDHPIAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKK 318
20026680  235 SIGYVAHQKHVSQFVLKEVEFRCRYTFARDYLVENKDNVISIDHRGAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKK 314
224020406 233 SIGYVAHQKHVSHFVMKEVEFKCRRMFPEK-TITCLDNVITIDHQNIKSTALFASCYNTHSIRGQSFNLLIVDESHFIKK 311
52139262  317 EAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISL 396
213159228 315 DAFNTILGFLAQHTTKIVFISSTNTATSATCFLTRLSNSPFDMLNVISYVCEEHMRAFSEKGDATACPCYRLHKPTFITI 394
51874288  309 DAFSTILGFLPQSSTKIIFISSTNSGNHSTSFLTKLSNSPFEMLTVVSYVCEDHVHILNDRGNATTCACYRLHKPKFISI 388
9633135   312 DAFSTILGFLPQASTKILFISSTNSGNHSTSFLMKLNNSPFEMLSVVSYVCEDHAHMLNERGNATACSCYRLHKPKFISI 391
14251081  319 DAFNTILGFLAQNTTKIIFISSTNTTTDATCFLTKLNNSPFDMLNVISYVCEEHIQVFSEKPDATACPCYRLHKPTFITI 398
20026680  315 EAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISL 394
224020406 312 DAFSTILGFLPQASTKILFISSTNSGNHSTSFLMKLNNSPFEMLSVVSYVCEDHAHMLNERGNATACSCYRLHKPKFISI 391
52139262  397 NSQVRKTANMFMPGAFMDEIIGGTNKISQNTVLITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAFTTNRKASGTG 476
213159228 395 SSEVRRTANMFLAGSFMDEIMGGTNKISEETVLITDDGREEFEMFRYSTINRKIRQSLGDTLYVYLDPAFTSNRRASGTG 474
51874288  389 NADVKKTADLFLEGAFKHEIMGGSLCNVVNDTLITEQGLIEFDLFRYSTISKQIIPFLGKELYIYIDPAYTINRRASGTG 468
9633135   392 NAEVKKTANLFLEGAFIHEIMGGATCNVINDVLITEQGQTEFEFFRYSTINKNLIPFLGKDLYVYLDPAYTGNRRASGTG 471
14251081  399 NSEVRQTANMFLAGSFMDEIMGGTNKIVEDTPLITDESREEFDIFRYSTMNKQLHPHLDRCLYVYLDPAFTSNKKASGTG 478
20026680  395 NSQVRKTANMFMPGAFMDEIIGGTNKIAQNNVLITDQSREEFDILRYSTLNTNAYDYFGKTLYIYLDPAFTTNRKASGTG 474
224020406 392 NAEVKKTANLFLEGAFIHEIMGGATCNVINDVLITEQGQTEFEFFRYSTINKNLIPFLGKDLYVYLDPAYTGNRRASGTG 471
52139262  477 VAAVGAYRHQFLIYGLEHFFLRDLSESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSS 556
213159228 475 IAAVGTYKNQLVIYGLEHYFLRDLLDSSEMAIAECAAHMLLSVLHLHPFIAEVRVAVEGNSNQAAAVRIACIIKQSIECA 554
51874288  469 VAAIGTYGDQYIIYGMEHYFLESLLSNSDASIAECASHMILAVLELHPFFTELKIIIEGNSNQSSAVKIACILKQTISVI 548
9633135   472 IAAIGTYLDQYIVYGMEHYFLESLMTSSDTAIAECAAHMILSILDLHPFFTEVKIIIEGNSNQASAVKIACIIKENITAN 551
14251081  479 IVALGRYREQYLIYGLEHYFLKDLLESSETAIAECAAHMLLAVLQLHPFFLEVRVTIEGNSNQAAAVRIACAIKQNILCN 558
20026680  475 VAAVGTYRHQFIIYGLEHFFLRDLSESSEVAISECAAHMAVSILSLHPYLDELRIAVEGNSNQAAAVRIACLIRQSVQST 554
224020406 472 IAAIGTYLDQYIVYGMEHYFLESLMTSSDTAIAECAAHMILSILDLHPFFTEVKIIIEGNSNQASAVKIACIIKENITAN 551
52139262  557 TLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQIQNLHRVTLAEgt 636
213159228 555 KAVRITFFHTPDQNEIEQPFYLMGKEKRLAVEAFIGKFNSGYVKASQELVSHTIKLSHDPVEYLLEQLKNIHRVVINE-- 632
51874288  549 RYKHITFFHTLDQSQIAQPFYLLGREKRLAVEYFISNFNSGYIKASQELISFTIKITYDPIEYVIEQIKNLHQININE-- 626
9633135   552 KSIQVTFFHTPDQNQIAQPFYLLGKEKKLAVEFFISNFNSGNIKASQELISFTIKITYDPVEYALEQIRNIHQISVNN-- 629
14251081  559 RHVVILFYHTPDQNEIEQPFYLLGREKRLAVESFIAKFNSGYIKASQELVSFTIKITYDPVDYLLEQLKNIQRITVNE-- 636
20026680  555 KLIRVLFYHTPDTNRIQQPFYLMGHDKALAVEQFISRFNSGYIKASQEVVSYTIKLNHDPIEYLLEQLQNLHRVTLAEgg 634
224020406 552 KSIQVTFFHTPDQNQIAQPFYLLGKEKKLAVEFFISNFNSGNIKASQELISFTIKITYDPVEYALEQIRNIHQISVNN-- 629
52139262  637 TARYSAKRQNrISDDLIIAVIMATYLCDDI-HAIRFRVS 674
213159228 633 YVTYSGKKHG-QTDDLVIAIIMATYICSETiNHHRFKAI 670
51874288  627 HVTYNAKKQT-CSDDLLISIIMAIYMCHEG-KQTSFKEI 663
9633135   630 YITYSAKKQA-CSDDLIIAIIMAIYVCSGN-SSASFREI 666
14251081  637 YVTYNAKKHN-CADDLAIALIMAVYLCLDE-RGYHFKPI 673
20026680  635 AGSYSAKRHQrFSDDLIIAVIMATYLCDEM-HAIHFRVS 672
224020406 630 YITYSAKKQA-CSDDLIIAIIMAIYVCSGN-SSASFREI 666
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap