Conserved Protein Domain Family
PHA03371

?
PHA03371: PHA03371 
circ protein; Provisional
Statistics
?
PSSM-Id: 177608
View PSSM: PHA03371
Aligned: 9 rows
Threshold Bit Score: 226.24
Threshold Setting Gi: 12084887
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
50313244    1 MGACCSSRRNRSPSLAALAEETEVVLRCLAGRVVDLPGGDEVRIAPDVGRPGQNFgYFKFPGPSRFAYVKFIGRAYALGS 80 
270339442  38 GGTASTTDSSRQSRLELAISTTQILLDGIAGRIIDLPNGDEFRVSADTGKTPDTL-VYVRTPTNHLKTLQFIGRAYAIAS 116
125745110   1 MGIIFSNPIERTDK---------TLIESLRGRNMDLPGGGDLWIFANAGTSTM---KFTTAGSRTSIQMYRVGRARTDGL 68 
122888766   1 MGSTLVRPSLNATAEENPASETRCLLRVLAGRTVDLPGGGTLHI--TCTKTYVIIgKYSKPG-ERLSLARLIGRAMTPGG 77 
12084887    1 MGSRCSKKSACVDK---------TLVQSLRGRNLDLPHGGYLGIFANAGATTV---RFVPSGSSRPMMLTHIGHACTDGL 68 
9629755     1 MGVCCSVRRKHSPSLTALAEETEIVLRCLAGRVVDLPGGDEVRIAPDVGRSGQNFgYFKFSGPSRFAYVKFIGRAYALGS 80 
9629819     1 MGARASAPAAGPPPAHA------VLLDALSGGTIDLPGGDEA-VFVSCPTTRPVYhHMRRGRTAHTTPVHFVGRAYAILP 73 
216905856   1 MGACCSTRRNRSPSLSALAEETEVVLRCLAGRVVDLPGGDEVRIAPDVGRPGQNFgYFKFPGPSRFAYVKFIGRAYALGS 80 
296316005   1 MGARASAPADGPPSTDA------VLLAALSGRTIDLPGGDEA-VFVSCPTTRPMYhHMRRGRAAHTTPVHFIGRAYAILP 73 
50313244   81 GRKFLLYLSRN--FQVFGYEDGTGLHMLAKSLHDFLKFKGLSDRDLVVVDSVALTSQLRPLTLPIRSTSDVETLVAEEAT 158
270339442 117 NRKFHIYLSKN--MSVLGYEQGSGLHFLAKSLQEFLTVYGLSKRDFKVMDRQLYGASMGPLIFPKPTNNDLIEVGIYTNQ 194
125745110  69 TREFVILKGQD--GNIYGVENASCIHFMSQNLHEFICKTGISQRDLMVTMGTFGGYKLN--------------------- 125
122888766  78 ARTFIILAMKEkrSTTLGYECGTGLHLLAPSMGTFLRTHGLSNRDLCLWRGNIYDMHMQRLMFWENIAQNTTET------ 151
12084887   69 LREFVIFEGQD--GSVYGTDNNVSLHFLGRNLHDILSKRGMSQRDVMVIKGKFFRSEIT--------------------- 125
9629755    81 GRKFLLYLSRN--YQVFGYEDGTGLHMLAKTLHDFLKFKGLSNRDLVVVDSVALTSQLRPLTLPIRSTSDVETLLAEEAT 158
9629819    74 CRKFMLYLMRG--GAVYGYEPTTGLHRLADSLHDFLTTAGLQQRDLHCLDVTVLDAQMDPVTF-----TTPEILIELEAD 146
216905856  81 GRKFLLYLSRN--FQVFGYEDGTGLHMLAKSLHDFLKFKGLSDRDLVVVDSVALTSQLRPLTLPIRSTSDVETLVAEEAT 158
296316005  74 CRKFMLYLTRG--GAVYGYEPATGLHRLADSLHELLTTDGLQQRDLQCLDVTVLDAQMDPVTF------TTPEILIELQA 145
50313244  159 TNYTSTENLLGQTQssthrplgv-plsnvktmgVPPTKPSSQRPRGKGGRPPARLKSIREETVSGMARAREECNSPSEHD 237
270339442 195 QPTLRGSGHTDLPL-------------------SGEQQPLLHEKQSLSTRLGRRYQSKSRSITLESNDDAHEGMIPSDIK 255
125745110 126 ---------------------------------SPPKRYHKYHDSSLGRRRGI--SVDRSANTASCTQYEHEWSASGVLS 170
122888766 152 ---------------------------------PCITSTLTCNLTEDSGEAALTTSDRPTLPTLTAQGRPTVSNIRGILK 198
12084887  126 ---------------------------------QLPKQRSRLKEKSDGSIRTCMDSVRINHNRSTVGHFGNSNAKRCTSA 172
9629755   159 TNHASTENLLGESQnthqqplsf--slpsirskAASQVQPSNQRLKGRVERATSHKSTLEETVSRKSNLCGEGNPPSEPN 236
9629819   147 PAFPPPPSARARRStlrrasmrrpartfcphqlLAEGSILDLCSPEQAAAPGCSLLPACDSGDAACPCDAGETARDCTAD 226
216905856 159 TNYTSTENLLGHTKssthrplcv-slsnvktieLPPTQPSSQRPKGKGGRPSARLKSIREETVSGTAKPREECNSPSEYD 237
296316005 146 DQAFPPPSARARRStlrraslrp-ptrafcphqLAEGSILDLCSPEQASAPSCSLLPARESGAAACPCDAREGACDCGSD 224
50313244  238 RLTSEMTDCDSDS---SVSSVFF 257
270339442 256 SRSRSISGYPHAQgddSIKSVLF 278
125745110 171 TINPNDRILSHGSskvRFGPTTV 193
122888766 199 GSPRQQPVCHRVRfaePTEGVLM 221
12084887  173 ITTPTMHIVTPAS---------- 185
9629755   237 CLTPEMADFDSDA---SVASVFF 256
9629819   227 AARAPSPGALSRYs--SVRSVFF 247
216905856 238 CLTSEMADCDSDS---SVASVFF 257
296316005 225 TTSAPSPGTSSRYg--SVHSVFF 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap