Conserved Protein Domain Family
PHA03370

?
PHA03370: PHA03370 
virion protein US2; Provisional
Statistics
?
PSSM-Id: 177607
View PSSM: PHA03370
Aligned: 4 rows
Threshold Bit Score: 430.842
Threshold Setting Gi: 255683165
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10834949    1 MGVSMITVVTLLDECERLPGRSRDAASALWIFLIKQCMEQIHDDVGVSVVVRSADLFRFSRPLLVLPRRQRPIIRTNPPD 80 
12084904    1 MGVCMITLVTLLDECDRLPGRSRDAASTLWIFLIEQCMEHLKNDVGVPILVRTADLCRFAKSTFVLPRRHRPIVRIKSAG 80 
125745124   1 MGVSMITIVTLLDECDRLPGRSRDAASTLWIFLIKQCMEQIQDDVGVPIIVRAADLFRFAKPMLILPRQHRPIVRTKPPD 80 
255683165   1 MGVVILSIATLIDENGRLPGRTRDASVHLWDILFKQCAKMMDDSLGIPVVIRPANLRRCAGKFMSMPRAHRPILRLTNPL 80 
10834949   81 GTGIRGTGLAGTRDSFIVRLFEDVGGCASEWQDVMSGYLMLESDVSENTSYSLWIVGAADLCRAALEYIPLPKRLLAVKV 160
12084904   81 GSGMPGSGLAGTRDAFIVRLFEDVAGCATEWQDLLTGYVMLESEASDNVSYSLWILGAADICRTAIESIPLPKRLFAIKV 160
125745124  81 GTGVRGTGLAGTRDSFIVRLFEDVAGCSTEWQDVLSGYLMLESEVSGNAPHSLWIVGAADICRIALECIPLPKRLLAIKV 160
255683165  81 GTGANGTGLAGRRDVPPVQFYED-GSESTEWTSVLAGYDHLSSGILGNHTFDMWIIGAADICKPAIEQLPNSKRFITIKV 159
10834949  161 AGTWSGMPWALPDTIPTLLTSTWEPTFETAEDKEHFRDN--GMTCVYKIIGSPPDPPKPPRTEPSRASSRSDKVFCCWPC 238
12084904  161 PGTWAGMPWAIPCEIQTLLTSTWEPKFENIEDKAYFNDS--NMACVYQIIGSPPDVPQLQGLGIESTCTPPKRNLCCCLC 238
125745124 161 SGTWSGMPWAIPDNIQTLLTSTWEPKFDTPEDRAHFCDS--DMVCVYKILGSPPNPLKPPEIEPPQMSSTPGRLFCCGKC 238
255683165 160 PGTWSGLTWEKPDGLSPLTVTEWDPCDDETMSKDIIEKKlvGIKCCYDLIGQPAAAKHNSELDDSKDVKCCNGPACCIAC 239
10834949  239 CKK-QEDQVSIPICYGNTKQDk----------kKCAKAAVITSE 271
12084904  239 CRPiHDDDASVPMGVKTVDKNvhdgnmlveapkCITDRGKFNSR 282
125745124 239 CKKeDRDAIAIPVRYTATGKS------------RIQKKCRAGSH 270
255683165     --------------------------------------------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap