Conserved Protein Domain Family
PHA03365

?
PHA03365: PHA03365 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177602
View PSSM: PHA03365
Aligned: 11 rows
Threshold Bit Score: 535.798
Threshold Setting Gi: 9628015
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24943098    4 SFPGSAHAALAKRSRSlsLRHSFRISRR----------------------EEHPETTFTRGMWKYELYKSHVKITNKQ-- 59 
82503264    4 AYPGGAHAALASRRSS--FRNSLRRLRP----------------------TEKPDTSFMRGVWKYEIFPSYVRVTNKQ-- 57 
83642852    1 -----MATEPETTPKQfwGLRSFRRFRT---------------------------TTQQLPHWTFSIFDTYIRFTNCH-- 46 
18653818    1 ---------MGTPVRF--FRGEWQTSSL----------------------VDNGTPRYSSLVWAATIHDGYLTLVNRS-- 45 
10140938    1 -------MQQTSNSNR--TMMSFRRFTT---------------------------TKLQLSHWDFTIYDTYIKMTNIH-- 42 
9631201     1 ----------MATPKH--IRGVWRRGSA----------------------MKQSERKFNYLFWSSSVHEHFITITNNQ-- 44 
9625967     1 ----------METPKH--IRGVWRRDSV----------------------LKHREKKFNYSFWNCSVHEHFISITNNR-- 44 
9628015    23 PHVTDGTVTYGRRAGT--MRDRGASLRPgagggggdgerpkrasslpapaSSSPGDPF----WSFSVYATYVKVTNKIrf 96 
51518076    4 AYPGGAHAALASRRSS--FRSSLRRLRP----------------------AEKPETSFVRGVWKYEIFASYVRVTNKQ-- 57 
139472810   1 MAQESEQCSRAFAVCS--SKRQLGRGEP---------------------------------VWDSVIHPSHIVISNRV-- 43 
139424538   4 AYPGGAHAALASRRSS--FRNSLRRLRP----------------------TEKPDTSFMRGVWKYEIFPSYVRVTNKQ-- 57 
24943098   60 VLELDATCQELPPCPSVGQIIRYQFPAFNFNSA-TYGSRYFTCAFVIFGDTENEVYLKPVFVLNSEQEVELQVLNPRNLY 138
82503264   58 VLQLDAQCQELPPCPSVGQILSFKLPSFSFNTT-TYGSRYFTVAFLFFGAEDNEVFLKPFFVMHSDQDIVLSVLNPRSLF 136
83642852   47 KINVTSSEAYLPTCPSLAVILKNTIPDYSFHSS-AWNCKTQWLRYMLFGDEDNPLSTRVSFIDSSATQIRIKLQHAAYQM 125
18653818   46 ELCVTERSPCLPACPSIGRLVGKRFPGFAFASA-TLGDRGTRTVFYAFGHRDNPLDIVPAVVERADRELVLRVHAPQTTR 124
10140938   43 HITTTSNDSCLPTCPPLAEILKDKIPGYAFYSS-AWQCQTMWMRFLIFGDEDNCIKTQLMFIDRSAENINIRLQHASYQM 121
9631201    45 EIQILPDDVLLARCPSIREIVGKQLPNFKFSGS-RYGPPGTITSFYVYGHCENVIKIKPMTISDCDQELIFKITFALECI 123
9625967    45 EIHILPDDLLLPRCPSIRAILFKQIPSFKFSGS-RSGPPGTVTSLYVYGHSKNLIKIKPMVVSECEQELIFKITFALECT 123
9628015    97 VPGMLADCT-LPYLPNLKNILAGRYPNFHFTTT-AHGGNLSEVAFLAVECPRNPVRAAPTVVRCSLNEIAISLMRPLEGP 174
51518076   58 VLQLDAQCQELPPCPSVGQIISFVFPSFSFNAT-TYGSRYFTCSFLFFGAEDNEVFLKPFFVMHSDQDIVLSVLNPRSLF 136
139472810  44 PLLLREQNICLPSCPSVGQILHRAYPNFTFDNThRKQQTETYTAFYAFGDQNNKVRILPTVVESSSSVLIFRLRASVSAN 123
139424538  58 VLQLDAQCQELPPCPSVGQILSFKLPSFSFNTT-TYGSRYFTVAFLFFGAEDNEVFLKPFFVMHSDQDIVLSVLNPRSLF 136
24943098  139 IDKGKFIWYMVPLRLVKTPYLYLRIFPNKGNINLETSCSQWGDKLSTNEPQIFLSGVPVSTQDES-LPFLLAQRTRPF-S 216
82503264  137 IEKGKFTWYIVPIRLVKNPYLYLQILPGQSDIQLTRSCTQSGDKLNTSEPQIFLSGSPVTSQDEC-LPYLLAQHTPPF-L 214
83642852  126 APAHSLIFYLVPITTLCLDHLYLRCRPDRQPCIMGSSCCQEVTRMDTSTPVLRMRGLMYSWEQEE-FPFLLGLKTKDL-D 203
18653818  125 VSRYGLKVFVAIVTVVRPPGVFLHFPQDRVPIALTDACSQEGSRLTSEEPWIKIQGFPVLSDETA-HPFLLTQKTKPFtE 203
10140938  122 APAHSLVFYIFPIILLRLDGLYLRVLPDKHPGVMDASCSQTWSCLNTPMPVVRLQGGMLSWDDED-MPFMLGQKTKPF-L 199
9631201   124 IPPGSMKIFILPITFLKLDGLYLLCLEDETSSIMTTSCMQMGTYLTSETPQVFLKGSPVLTKNEP-LPHLMAQKTKPF-N 201
9625967   124 IPPGSMEIFILPITFLKLDGLYLLCLEDYTSRIMSTSCMQMGTYLASETPQVFLKGGPVLNKHEP-MPYLMAQKTKPF-D 201
9628015   175 VPAGGLTFYLLPVTLVKPHGLYLKIQKDRAAVGAATTCSQDGAHLNSEQPQVFFSGTAAPAREGGeLPFLLAQRTPRFeR 254
51518076  137 IEKGRLTWYIVPIRLVKNPYLYLQILPGQSDIKLTRSCSQSGDNLNTSEPQIFLSGSPVSSQDEC-LPYLLAQHTTPF-L 214
139472810 124 IAVGGLKIIILALTLVHAQGVYLRCGKDLSTPHCAPAIVQREVLSSGFEPQFTVTGIPVTSSNLN-QCYFLVRKPKSRlA 202
139424538 137 IEKGKFTWYIVPIRLVKNPYLYLQILPGQSDIQLTRSCTQSGDKLNTSEPQIFLSGSPVTSQDEC-LPYLLAQHTPPF-L 214
24943098  217 KPFARIHTFPGKVCPVNALRLDKTCVRVSV-DVPTEKp--KAREEPIKIGMTLLNDVILAFKYNPYPKSTWRWDGES-TE 292
82503264  215 KSYARIHTFPGKVCPVNAIRRGKGYVRVSV-DTPDLK---REGPLNVKVGMTLLDDVIIAFRYNPYPKSHWRWDGES-TD 289
83642852  204 SKFVRVRTVEGEVCKVNDVCMGSNYIKVHV-DYHYS----LDRRTIVDVCLSPTSSAVISFKYSPFVKSPWVPNAAS-VP 277
18653818  204 RKFCRLIMDNDQRSAVNTVYLGKQHVRVTV-TRPPET---IVTDGPVTATLSLTGNAPIAFRHNPYFELPWSSTTAIfTP 279
10140938  200 SKAVKVHALADEVCKVNDVCMGDNYMKIHL-DFHFA----LDKHLPVDICMSPTNNTVLSFKFNPFVKTPWEPTPAK-VP 273
9631201   202 KKMARVHTVQNEVCEVNSIYKGKDHIRLAL-QKKSED---VNFFEPVIIGLTMTNKALIAFQHNPYYFCPWDWGRQS-IP 276
9625967   202 KKMARVHTVQNEVCEVNSIYRGENHVKVAI-QKDSED---INFLDTVVVGLTMTNRALVAFEYNPYFSCPWDWKRQS-IP 276
9628015   255 GGFCKVHVTQGVTCPVNAVKLSNDYVRLPVcELRGDGgagAAAPSQIKVGVTLVREAMLAFRYNPYLFSPWCWAEAT-VP 333
51518076  215 KSYARIHTFPGKVCPVNAVRRGKGYVRVSV-DTPDLK---REGPLNVKVGMTLLDDVIIAFRYNPYPKSTWRWDGES-TD 289
139472810 203 KPFARLSAETTEECRVRSIRLGKTHLRISV-TAPAQE---TPVWGLVTTSFSLTPTAPLAFDRNPYNHETFACNARHyIP 278
139424538 215 KSYARIHTFPGKVCPVNAIRRGKGYVRVSV-DTPDLK---REGPLNVKVGMTLLDDVIIAFRYNPYPKSHWRWDGES-TD 289
24943098  293 IRYFGSPVIIPPNFITSVDYNNTYETPLSTKITALIL----SHPN-NQVFYIYPQEWKPGQTIKLMVRNISNFPITIITG 367
82503264  290 IRYFGSPVIIPPNFITELEYNNTYEAPLSSKITAVVV----SHSS-NPVFYVYPQEWKPGQTLKLTVRNISNNPITIVTG 364
83642852  278 IVYMGPPIIIPSLCSTVIEYCNKYYVTKGLNVTAMLL----GLEGdDIEFEAEASVWAPTCTAQISVFNKSAFTRTLTEG 353
18653818  280 VVYVGLTVCIPPNCSKFVRYGNTYVSAFNRKLTAIIS----NHAH-NGGFRIQDCEWPPNREIEILVTNVSQAPVYISTG 354
10140938  274 IVYMGEPVLIPGSCSTIVEYCNRYYVAKGLRITAIIV----SVETdDTEFETDVCEWASECTAKIMVSNKSLFPRTLAPG 349
9631201   277 IIYVGPSIRIPADRHAVVKYNNMY-SSTYANITAMIT----NCET-CPDFHISDCEWKPESPVYINVTNTLNIAITISSG 350
9625967   277 IIYDGPCIRIPAGRLAPVKYNNTY-SSIYPNATAIIT----NSDS-CADFHISDCEWKPGKTACIVVTNTSTISVTISSG 350
9628015   334 IHYYGPPVIVPAGQAARVVYGNVYYAPMLDELTAVIAppldGDGD-RRFGLMGCCEWPKGGHAELAVENRTCFLQVLRTG 412
51518076  290 IRYFGSPVIIPPNFITELEYNNTYEAPLSSKITALVV----SHPT-NPVFYVYPQEWKPGQPLKLTVRNISNKPIEIVTG 364
139472810 279 VIYSGPKITLAPRGRQVVWHNNSYTSSLPCKVTAIVS----NHCC-NCDIFLEDSEWRPNKPAPLKLVNTSDHPVILEPD 353
139424538 290 IRYFGSPVIIPPNFITELEYNNTYEAPLSSKITAVVV----SHSS-NPVFYVYPQEWKPGQTLKLTVRNISNNPITIVTG 364
24943098  368 QPLAQAFFIYNSGEGLSTMM-KRAVHRHQHVLTLPGNIMAVIGCLPTFERINKSCNGN 424
82503264  365 QSMAQAFFIYAGDPSISTIM-RRYIQRQGCALTLPGNIVVESSSLPTFERINKTFNGN 421
83642852  354 THLANAIFVVAEKQLLANVLtQSQLRCLTTCLKLPGGFCANAAKLPRISLTNAKKKC- 410
18653818  355 TQLGQAIFVFAPRFGGPAKL-RQLLGHRSRALELPGGVTVDSQKLCRFETMYLFST-- 409
10140938  350 THIANAHFLLAERHFFSRILsDKNLKKLSTCIKLPGGFWVNAAKLPKLCKTCLSERV- 406
9631201   351 TKLGEAVFLLAPKFLCKKIIsKKHVQTLPSAVTLPGNVTINSNKLPKLADLTTYK--- 405
9625967   351 THLGEAVFILAPKFFCRKIMsKTHVQKLSSAICLPGNVTINSNKVPKLADLSTYK--- 405
9628015   413 DRLGYAIFFIAPRIPMVNLLpARYRENLSVAVTVVGGVTLNASKLHKIAELAQPLATQ 470
51518076  365 QSLAQAFFIYAGDPSLGTLM-RRYIQRQGCALTLPGNIVVESSSLPTFERINKTFNGN 421
139472810 354 THIGNALFIIAPKARGL----RRLTRLTTKTIELPGGVKIDSRKLQTFRKMYVATGRS 407
139424538 365 QSMAQAFFIYAGDPSISTIM-RRYIQRQGCALTLPGNIVVESSSLPTFERINKTFNGN 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap