Conserved Protein Domain Family
PHA03360

?
PHA03360: PHA03360 
tegument protein; Provisional
Statistics
?
PSSM-Id: 177598
View PSSM: PHA03360
Aligned: 3 rows
Threshold Bit Score: 779.867
Threshold Setting Gi: 51874286
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633133    1 METHLYYDTLYQY-QGGVYPAHICLPTDAYLPM-RVDCIESLYFRCVFFKNGMHYTEWSKLKFTVISREIKFKDVLKNAD 78 
9628366    1 METHLYYDTLYQY-QGGVYPAHICLPTDVCLPM-RVDCIESLYFRCVFFKSGMHYTEWSKLKFTVISREIKFKDVLKDAD 78 
51874286   1 MEMHLLCETMFTCrKNNILPVHLCILLDDVIHKeKVKAIEGIFFQCVFFKEKLVYTEWTKIKFTYVLHDLVISQIFKNAC 80 
9633133   79 FDELFTGLVVMTIPIPIVDFHFDIDSVILKLVYPQLVHREIVLRLYDLICIRPSSDRPSEVSAKNIGIDFYQLTSQGNKQ 158
9628366   79 SDEVFTGLVVMTIPIPIVDFHFDIDSVILKLVYPRLVHREIVLRLYDLICVRPPSNRPSEASAKNIANDFYQLTSRENKQ 158
51874286  81 IKEVIHGALILSVPINIDNLHFDTDILILKIIYPHFLHDDIVIKLSEILSGAPRIQKTVE-KKQEVEKPFFHIPAKLGDL 159
9633133  159 TPDEEKRCLFFQQGPLEPPSTVRGLKAAGNAKPMQFPAHVNEKMTESFLSDSWFEQKVRCKKILDFTQTYRVVVCWYELS 238
9628366  159 TPDEEKRCLFFQQGPLEPPSTVRGLKAPGNEKPIQFPAHANEKMTESFLSDSWFGQKVRCKKILDFTQTYQVVVCWYELS 238
51874286 160 T--KEDPISFNHHGPLEPPSTVRGLKQSANVRH-SHPISRPEKANVTFLSDSWYSQNLKCDFISDIQQRHVLVIFWYELS 236
9633133  239 FSREMQIENNLLSASQLKRVNAADFWDRTDRYLRDIGSRVLTHIVKTLQIHNRQFKQKFNCNFPVNFSFEHLLSFMQLGK 318
9628366  239 FSREMQIENNLLSASQLKRVNAADFWDRTNRYLRDIGSRVLTHIVKTLQIHNRQFKQKFNCNFPDNFSFDRLLSFMQLGK 318
51874286 237 KGIQMQIKNIQIPPENLFS-SITNYLDRVNTYLDEIAERTFRCITTNMEIQNRHLPQKFNSHFQIEFNCTHLIYGMELAR 315
9633133  319 DFWILNLTLDSCIIKAIICFLGFRNGRKSFLAQDEVWGDLIDCSKGSVIYGEKIQWILDSTNNLYSTRREKQNKSWELYV 398
9628366  319 DFWILNLTLDSCIIKAIICFLGFQNGGKSFLAQDEVWGDLIDCSKGSVIYGEKIQWILDSTNNLYSTCREKQNKSWELYV 398
51874286 316 DFWILSLDRNSCVLKAMASHFLHKKKGRSSLSSNEFWADLIDCTTGKTLYGEKVRWQLNSETSLYSTFRKNQNISWELQP 395
9633133  399 DCCALYVSEKLELDFVLPGGFAITGKFALTDGDIDFFNWRFGLS 442
9628366  399 DCCALYVSEKLELDFVLPGGFAITGKFALTDGDIDFFNWRFGLS 442
51874286 396 NCYALYMSENLKLYWVLPGGFCVSGTFKLKENDEFFFDWQFGMS 439
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap